# DREXEL TRIFLURALIN 4EC HERBICIDE - EPA Reg No: **19713-254** - Registrant: DREXEL CHEMICAL COMPANY - Signal word: Caution - Active ingredients: Trifluralin (44.5%) - Label accepted: 2024-10-10 - Source PDF: https://www3.epa.gov/pesticides/chem_search/ppls/019713-00254-20241010.pdf --- 1 October 10, 2024 Eliot Harrison Agent for Drexel Chemical Company c/o Lewis & Harrison, LLC 2461 S. Clark St., Suite 710 Arlington, VA 22202 Subject: Label Amendment – Add Use on Se same, Add Tank Mixing Statement, and Other Minor Typographical Changes Product Name: Drexel Trifluralin 4EC Herbicide EPA Registration Number: 19713-254 Application Date: March 26, 2022 Case Number: 482544 Dear Eliot Harrison: The amended label referred to above, submitted in connection with registration under the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA), as amended, is acceptable. This approval does not affect any conditions that were previously imposed on this registration. You continue to be subject to existing conditions on your registration and any deadlines connected with them. A stamped copy of your labeling is enclosed for your records. This labeling supersedes all previously accepted labeling. You must submit one copy of the final printed labeling before you release the product for shipment with the new labeling. In accordance with 40 CFR 152.130(c), you may distribute or sell this product under the previously approved labeling for 18 months from the date of this letter. After 18 months, you may only distribute or sell this product if it bears this new revised labeling or subsequently approved labeling. “To distribute or sell” is defined under FIFRA section 2(gg) and its implementing regulation at 40 CFR 152.3. Should you wish to add/retain a reference to the company’s website on your label, then please be aware that the website becomes labeling under FIFRA and is subject to review by the Agency. If the website is false or misleading, the product would be misbranded and unlawful to sell or distribute under FIFRA section 12(a)(1)(E). 40 CFR 156.10(a)(5) lists examples of statements EPA may consider false or misleading. In addition, regardless of whether a website is referenced on your product’s label, claims made on the website may not substantially differ from those claims approved through the registration process. Therefore, should the Agency find Page 2 of 2 EPA Reg. No. 19713-254 Case No. 482544 or if it is brought to our attention that a website contains false or misleading statements or claims substantially differing from the EPA approved registration, the website will be referred to the EPA’s Office of Enforcement and Compliance. Your release for shipment of the product constitutes acceptance of these conditions. If these conditions are not complied with, the registration will be subject to cancellation in accordance with FIFRA section 6. If you have any questions, please contact Derek Corbin at 202-566-2571 or at Corbin.Derek@epa.gov. Sincerely, Kable Bo Davis Senior Regulatory Specialist Office of Pesticide Programs Registration Division, Immediate Office Enclosure Drexel Trifluralin 4EC Herbicide, EPA Reg. 19713-254, Rev. October 9, 2024, Page 1 of 57 A selective herbicide for pre-emergence control of Annual grasses and Broadleaf weeds. ACTIVE INGREDIENT: 7ULIOXUDOLQ ĮĮĮ-trifluoro--dinitro-1N-dipropyl-p-toluidine)* …………………………….............. 44.5% OTHER INGREDIENTS**: ................................................................................................................. 55.5% TOTAL: ..........................................................................................................................................100.0% *This product contains 4 pounds of Trifluralin per gallon. **Contains petroleum distillates. KEEP OUT OF REACH OF CHILDREN CAUTION [See FIRST AID Below] [See Side (Back) Panel for FIRST AID]; [See Page ___ for FIRST AID] [See Container Labeling for (FIRST AID and) Complete Directions for Use] [See (Attached) Booklet (Container Labeling) for Complete Directions for Use] EPA Reg. No. 19713-254 EPA Est. No. 19713-XX-XXX Net Co ntents:______Gals. (______L) FIRST AID IF IN EYES: • Hold eye open and rinse slowly and gently with water for 15 to 20 minutes. ‡5HPRYHFRQWDFWOHQVHVLISUHVHQWDIWHUWKHILUVWPLQXWHVWKHQFRQWLQXHULQVLQJH\H • Call a poison control center or doctor for treatment advice. IF SWALLOWED: • Call a poison control center or doctor immediately for treatment advice. • Do not give any liquid to the person. • Do not induce vomiting unless told to do so by a poison control center or doctor. • Do not give anything by mouth to an unconscious or convulsing person. IF ON SKIN OR CLOTHING: • Take off contaminated clothing. • Rinse skin immediately with plenty of water for 15 to 20 minutes. • Call a poison control center or doctor for treatment advice. IF INHALED: • Move person to fresh air. ‡,ISHUVRQLVQRWEUHDWKLQJFDOORUDQDPEXODQFHWKHQJLYHDUWLILFLDOUHVSLUDWLRQSUHIHUDEO\by mouth-to-PRXWKLI possible. • Call a poison control center or doctor for further treatment advice. Have the product container or label with you when calling a poison control center or doctor or going for treatment. You may also call CHEMTREC at 800-424-IRUHPHUJHQF\medical treatment information. NOTE TO PHYSICIAN: This product contains an aromatic hydrocarbon and can be extremely harmful if swallowed. Aspiration of this product may produce a severe pneumonitis. Stomach lavage with a cuffed endotracheal tube in place and immediate administration of activated charcoal   WR  KHDSLQJ WHDVSRRQIXO ZLWK ZDWHU VKRXOG EH FRQVLGHUHG Treatment is otherwise symptomatic and supportive. Manufactured By: 254SP-0720* TRIFLURALIN GROUP 3 HERBICIDE Trifluralin 4EC Herbicide 10/10/2024 19713-254 Drexel Trifluralin 4EC Herbicide, EPA Reg. 19713-254, Rev. October 9, 2024, Page 2 of 57 PRECAUTIONARY STATEMENTS Hazards to Humans and Domestic Animals CAUTION: +DUPIXOLIDEVRUEHGWKURXJKVNLQ&DXVHVPRGHUDWHH\HLUULWDWLRQ$YRLGFRQWDFWZLWKH\HVVNLQRUFORWKLQJ Prolonged or frequently repeated skin contact may cause allergic reaction in some individuals. Wash thoroughly with soap and water after handling. PERSONAL PROTECTIVE EQUIPMENT (PPE) Applicators and other handlers must wear: Long-VOHHYHVKLUWDQGORQJSDQWVVRFNVDQGVKRHVDQGFKHPLFDO-resistant gloves made of barrier laminate or viton > 14 mils. Discard clothing and other absorbent materials that have been drenched or heavily contaminated with this product’s concentrate. Do not reuse them. Follow manufacturer’s instructions for cleaning/maintaining PPE. If no such instructions IRUZDVKDEOHVH[LVWXVHGHWHUJHQWDQGKRWZDWHU.HHSDQGZDVK33(VHSDrately from other laundry. ENGINEERING CONTROLS :KHQ KDQGOHUV XVH FORVHG V\VWHPV HQFORVHG FDEV RU DLUFUDIW LQDPDQQHU WKDWPHHWVWKH UHTXLUHPHQWVOLVWHG LQ WKH Worker Protection Standard (WPS) for agricultural pesticides [40 CFR 170. G-f)@WKHKDQdler PPE requirements may be reduced or modified as specified in the WPS. USER SAFETY RECOMMENDATIONS Users should: 1) Wash hands thoroughly after handling and before HDWLQJGULQNLQJFKHZLQJJXPXVLQJWREDFFRRU using the toilet. 2) Remove clothing/PPE immediately if pesticide gets inside. Then wash thoroughly and put on clean FORWKLQJ 5HPRYH33(LPPHGLDWHO\DIWHUKDQGOLQJWKLVSURGXFW:DVKWKHRXWVLGHRIJORYHs before removing. As VRRQDVSRVVLEOHZDVKWKRURXJKO\DQGFKDQJHLQWRFOHDQFORWKLQJ ENVIRONMENTAL HAZARDS 7KLVSHVWLFLGHLVH[WUHPHO\WR[LFWRIUHVKZDWHUPDULQHDQGHVWXDULQHILVKDQGDTXDWLFLQYHUWHEUDWHVLQFOXGLQJVKULPSDQG oysters. Do not apply LQDPDQQHUZKLFKZLOOGLUHFWO\H[SRVHFDQDOVODNHVVWUHDPVSRQGVPDUVKHVRUHVWXDULHVWRDHULDO drift. Do not contaminate water when disposing of equipment washwaters. Do not apply directly to water or to areas where surface water is present or to intertidal areas below the mean high water mark. NON-TARGET ORGANISMS ADVISORY STATEMENT This product is toxic to plants and may adversely impact the forage and habitat of non-target organisms including pollinators in areas adjacent to the treated site. Protect the forage and habitat of non-target organisms by following label directions intended to minimize spray drift. PHYSICAL AND CHEMICAL HAZARDS Combustible. Do not use or store near heat or open flame. DIRECTIONS FOR USE It is a violation of Federal law to use this product in a manner inconsistent with its labeling. Read all directions for use before applying this product. Do not apply this pURGXFWLQDZD\WKDWZLOOFRQWDFWZRUNHUVRURWKHUSHUVRQVHLWKHUGLUHFWO\ or through drift. Only protected handlers may be in the area during application. For any requirements specific to your 6WDWHDQG7ULEHFRQVXOWWKHDJHQF\UHVSRQVLEOHIRUSHVWLFLGH regulation. AGRICULTURAL USE REQUIREMENTS 8VHWKLVSURGXFWRQO\LQDFFRUGDQFHZLWKLWVODEHOLQJDQGZLWKWKH:RUNHU3URWHFWLRQ6WDQGDUG :36 &)53DUW  7KLV VWDQGDUG FRQWDLQV UHTXLUHPHQWV IRU WKH SURWHFWLRQ RIDJULFXOWXUDO ZRUNHUV RQ IDUPV IRUHVWV QXUVHULHV greenhouses and handlers of aJULFXOWXUDOSHVWLFLGHV,WFRQWDLQVUHTXLUHPHQWVIRUWUDLQLQJGHFRQWDPLQDWLRQQRWLILFDWLRQ and emergency assistance. It also contains specific instructions and exemptions pertaining to the statements on this label about personal protective equipment (PPE) and restricted entry interval (REI). The requirements in this box only apply to uses of this product that are covered by the WPS. Do not enter or allow worker entry into treated areas during the REI of 12 hours. EXCEPTION: If the product is soil-LQMHFWHGRUVRLOLQFRUSRUDWHGWKH:36XQGHUFHUWDLQFLUFXPVWDQFHVDOORZVZRUNHUV to enter the treated area if there will be no contact with anything that has been treated. PPE required for early entry to treated areas that is perPLWWHGXQGHUWKH:36DQGWKDWLQYROYHVFRQWDFWZLWKDQ\WKLQJWKDWKDVEHHQWUHDWHGVXFKDV SODQWVVRLORUZDWHULV&RYHUDOOVVRFNVSOXVVKRHVDQGFKHPLFDO-resistant footwear and chemical-resistant gloves made of barrier laminate or viton > 14 mils. Drexel Trifluralin 4EC Herbicide, EPA Reg. 19713-254, Rev. October 9, 2024, Page 3 of 57 NON-AGRICULTURAL USE REQUIREMENTS The requirements in this box apply to uses of this product that are NOT within the scope of the Worker Protection 6WDQGDUG  &)5 3DUW  7KH :36 DSSOLHV ZKHQ WKLV SURGXFW LV XVHG WR SURGXFH DJULFXOWXUDO SODQWV RQ IDUPV IRUHVWVQXUVHULHVDQGJUHHQKRXVHV Do not enter treated areas until sprays have dried. PRODUCT INFORMATION TRIFLURALIN 4EC is a selective herbicide for the pre-emergence control of Annual grasses and Broadleaf weeds. This product may be applied in liquid sprays of water or liquid fertilizer or impregnated on dry bulk fertilizer. To prevent loss of KHUELFLGDO DFWLYLW\ WKLV SURGXFW PXVW EH VRLO LQFRUSRUDWHG ZLWKLQ  KRXUV DIWHU DSSOLFDWLRQ 7KLV SURGXFWPD\EH WDQN- mixed or followed by overlay or post-emergence treatment with other herbicides to improve the spectrum of weeds controlled. This product controls weeds by disrupting growth processes during germination. This product does not control established weeds. Use Precautions: $SSOLHGDFFRUGLQJWRGLUHFWLRQVDQGXQGHUQRUPDOJURZLQJFRQGLWLRQVWKLVSURGXFWZLOOQRWKDUPWKHWUHDWHGFURS2YHU- application may result in crop injury or rotational crop damage from soil residue. Uneven application or improper incorporation of this p URGXFW FDQ UHVXOW LQ HUUDWLF ZHHG FRQWURO RU FURS LQMXU\ 6HHGOLQJ GLVHDVH FROG ZHDWKHU GHHS SODQWLQJH[FHVVLYHPRLVWXUHKLJKVDOWFRQFHQWUDWLRQRUGURXJKWPD\ZHDNHQFURSVHHGOLQJVDQGLQFUHDVHWKHSRVVLELOLW\ of damage from this product. Under these FRQGLWLRQVGHOD\HGFURSGHYHORSPHQWRUUHGXFHG\LHOGVPD\UHVXOW 'R QRW apply this product to soils that are wet or are subjected to prolonged periods of flooding as poor weed control may result. Restrictions: Do not use this product on any crop grown LQ3HFRV&RXQW\RU5HHYHV&RXQW\7;'RQRWXVHLQ0ontana. Chemigation: This product may be applied by chemigation on certain crops. See instructions for chemigation in the “CROPS” section of this label. WEED RESISTANCE MANAGEMENT TRIFLURALIN GROUP 3 HERBICIDE )RUUHVLVWDQFHPDQDJHPHQWWKLVSURGXFWLVD*URXSPRGHRIDFWLRQKHUELFLGH$Q\ZHHGSRSXODWLRQPD\FRQWDLQRU GHYHORSSODQWVQDWXUDOO\UHVLVWDQWWRWKLVSURGXFWDQGRWKHU*URXSPRGHRIDFWLRQKHUELFLGHV7KHUHVLVWDQWELRW\SHVPD\ dominate the weed population if these herbicides are used repeatedly in the same field. Appropriate resistance management strategies should be followed. 7RGHOD\KHUELFLGHUHVLVWDQFHWDNHRQHRUPRUHRIWKHIROORZLQJVWHSV x 5RWDWH WKH XVH RI WKLV SURGXFW RU RWKHU *URXS  KHUELFLGHV ZLWKLQ D JURZLQJ VHDVRQ VHTXHQFH RU DPRQJ JURZLQJ seasons with different herbicide groups that control the same weeds in a field. x Use tank-mixtures with herbicides from a different group if such use is permitted; where information on resistance in WDUJHWZHHGVSHFLHVLVDYDLODEOHXVHWKHOHVVUHVLVWDQFH-prone partner at a rate that will control the target weed(s) equally as well as the more resistance-prone partner. Consult your local extension service or certified crop advisor if you are unsure as to which active ingredient is currently less prone to resistance. x Adopt an integrated weed-management program for herbicide use that includes scouting and uses historical information related to herbicidHXVHDQGFURSURWDWLRQDQGWKDWFRQVLGHUVWLOODJH RURWKHUPHFKDQLFDOFRQWUROPHWKRGV  FXOWXUDO HJKLJKHUFURSVHHGLQJUDWHVSUHFLVLRQIHUWLOL]HUDSSOLFDWLRQPHWKRGDQGWLPLQJWRIDYRUWKHFURSDQGQRW WKHZHHGV ELRORJLFDO ZHHG-competitive crops or varieties) and other management practices. x Scout after herbicide application to monitor weed populations for early signs of resistance development. Indicators of possible herbicide resistance include: (1) failure to control a weed species normally controlled by the herbicide at the GRVHDSSOLHGHVSHFLDOO\LIFRQWUROLVDFKLHYHGRQDGMDFHQWZHHGV  DVSUHDGLQJSDWFKRIQRQ-controlled plants of a SDUWLFXODU ZHHG VSHFLHV  VXUYLYLQJ SODQWVPL[HG ZLWKFRQWUROOHG LQGLYLGXDOV RIWKH VDPH VSHFLHV,I resistance is VXVSHFWHGSUHYHQWZHHGVHHGSURGXFWLRQLQWKHDIIHFWHGDUHDE\DQDOWHUQDWLYHKHUELFLGHIURPDGLIIHUHQWJURXSRUE\ a mechanical method such as hoeing or tillage. Prevent movement of resistant weed seeds to other fields by cleaning harvestLQJDQGWLOODJHHTXLSPHQWZKHQPRYLQJEHWZHHQILHOGVDQGSODQWLQJFOHDQVHHG x ,IDZHHGSHVWSRSXODWLRQFRQWLQXHVWRSURJUHVVDIWHUWUHDWPHQWZLWKWKLVSURGXFWGLVFRQWLQXHXVHRIWKLVSURGXFWDQG switch to another management strategy or herbicide with DGLIIHUHQWPRGHRIDFWLRQLIDYDLODEOH x Contact your local extension specialist or certified crop advisors for additional pesticide resistance-management and/or integrated weed-management recommendations for specific crops and weed biotypes. x For furtheULQIRUPDWLRQRUWRUHSRUWVXVSHFWHGUHVLVWDQFHFRQWDFW'UH[HO&KHPLFDO&RPSDQ\UHSUHVHQWDWLYHVDW   774- Drexel Trifluralin 4EC Herbicide, EPA Reg. 19713-254, Rev. October 9, 2024, Page 4 of 57 MANDATORY SPRAY DRIFT MANAGEMENT AERIAL APPLICATIONS: • 'RQRWUHOHDVHVSUD\DWDKHLJKWJUHDWHUWKDQIHHWDERYHWKHJURXQGRUYHJHWDWLYHFDQRS\XQOHVVDJUHDWHU application height is necessary for pilot safety. • Applicators are required to use a coarse or coarser droplet size (ASABE S572). • If the wind sSHHGLVPLOHVSHUKRXU PSK RUOHVVDSSOLFDWRUVPXVWXVHRQH-half swath displacement upwind at WKHGRZQZLQGHGJHRIWKHILHOG:KHQWKHZLQGVSHHGLVEHWZHHQWRPSKDSSOLFDWRUVPXVWXVHWKUHH- fourth swath displacement upwind at the downwind edge of the field. ‡'RQRWDSSO\ZKHQZLQGVSHHGVH[FHHGPSKDWWKHDSSOLFDWLRQVLWH,IWKLVZLQGVSHHGLVJUHDWHUWKDQPSK WKHERRPOHQJWKPXVWEHRUOHVVRIWKHZLQJVSDQIRUIL[HGZLQJDLUFUDIWDQGRUOHVVRIWKHURWRU diameter for helicopWHUV2WKHUZLVHWKHERRPOHQJWKPXVWEHRUOHVVRIWKHZLQJVSDQIRUIL[HGZLQJDLUFUDIW DQGRUOHVVRIWKHURWRUGLDPHWHUIRUKHOLFRSWHUV • Do not apply during temperature inversions. GROUND BOOM APPLICATIONS: • User must only apply with the reOHDVHKHLJKWUHFRPPHQGHGE\WKHPDQXIDFWXUHUEXWQRPRUHWKDQIHHWDERYH the ground or crop canopy. • Applicators are required to use a coarse or coarser droplet size (ASABE S572). • Do not apply when wind speeds exceed 15 miles per hour at the application site. • Do not apply during temperature inversions. SPRAY DRIFT ADVISORIES 7+($33/,&$725,65(63216,%/()25$92,',1*2))-SITE SPRAY DRIFT. BE AWARE OF NEARBY NON-7$5*(76,7(6$1'(19,5210(17$/&21',7,216 IMPORTANCE OF DROPLET SIZE An effective way to reduce spray drift is to apply large droplets. Use the largest droplets that provide target pest control. :KLOH DSSO\LQJ ODUJHU GURSOHWV ZLOO UHGXFH VSUD\ GULIW WKH SRWHQWLDO IRU GULIW ZLOO EH JUHDWHU LI DSSOLFDWLRQV DUH PDGH improperly or under unfavorable environmental conditions. Controlling Droplet Size - Ground Boom • Volume- Increasing the spray volume so that larger droplets are produced will reduce spray drift. Use the highest practical spray volume for the application. If a grHDWHUVSUD\YROXPHLVQHHGHGFRQVLGHUXVLQJDQR]]OHZLWKDKLJKHU flow rate. • Pressure- Use the lowest spray pressure recommended for the nozzle to produce the target spray volume and droplet size. • Spray Nozzle- Use a spray nozzle that is designed for the intended application. Consider using nozzles designed to reduce drift. Controlling Droplet Size - Aircraft • Adjust Nozzles- )ROORZQR]]OHPDQXIDFWXUHU¶VUHFRPPHQGDWLRQVIRUVHWWLQJXSQR]]OHV*HQHUDOO\WRUHGXFHILQH GURSOHWVQR]]OHVVKRXOGEHoriented parallel with the airflow in flight. BOOM HEIGHT *URXQG%RRP)RUJURXQGHTXLSPHQWWKHERRPVKRXOGUHPDLQOHYHOZLWKWKHFURSDQGKDYHPLQLPDOERXQFH RELEASE HEIGHT - AIRCRAFT Aircraft: Higher release heights increase the potential for spray drift. SHIELDED SPRAYERS Shielding the boom or individual nozzles can reduce spray drift. Consider using shielded sprayers. Verify that the shields are not interfering with the uniform deposition of the spray on the target area. TEMPERATURE AND HUMIDITY :KHQPDNLQJDSSOLFDWLRQVLQKRWDQGGU\FRQGLWLRQVXVHODUJHUGURSOHWVWRUHGXFHHIIHFWVRIHYDSRUDWLRQ Drexel Trifluralin 4EC Herbicide, EPA Reg. 19713-254, Rev. October 9, 2024, Page 5 of 57 TEMPERATURE INVERSIONS Drift potential is high during a temperature inversion. Temperature inversions are characterized by increasing temperature with altitude and are common on nights with limited cloud cover and light to no wind. The presence of an inversion can be indicated by ground fog or by the movement of smoke from a ground source or an aircraft smoke generator. Smoke WKDWOD\HUVDQGPRYHVODWHUDOO\LQDFRQFHQWUDWHGFORXG XQGHUORZZLQGFRQGLWLRQV LQGLFDWHVDQLQYHUVLRQZKLOHVPRNH that moves upward and rapidly dissipates indicates good vertical air mixing. Avoid applications during temperature inversions. WIND 'ULIWSRWHQWLDOJHQHUDOO\LQFUHDVHVZLWKZLQGVSHHG$92,'$33/,&$7,216'85,1**867<:,1'&21',7,216 Applicators need to be familiar with local wind patterns and terrain that could affect spray drift. MIXING INSTRUCTIONS This Product Alone: This product may be mixed with water or most liquid fertilizer materials. Prior to mixing this product LQOLTXLGIHUWLOL]HUUHIHUWRWKHODEHOVHFWLRQHQWLWOHG“Testing for Compatibility in Liquid Fertilizers” for testing procedures to determine compatibility with the liquid fertilizer product to be used. The combination of this product with solution and suspension-type fertilizers provides weed and grass control equal to water sprays. Fill spray tank one-third to one-half full with clean water or liquid fertilizer. Start agitation. Add correct amount of this product and continue agitation while filling tank to required spray volume. It is the pesticide user’s responsibility to ensure that all products are registered for the intended use. Read and follow the applicable restrictions, limitations, and directions for use on all product labels involved in the tank mixture. Users must follow the most restrictive directions for use and precautionary statements of each product in the tank mixture. Restriction: Do not allow water or spray mixture to back siphon into a water source. This Product in Tank-mix: This product may be tank-mixed with other products and applied with water or most liquid fertilizer materials. Prior to mixing tank-mixes containing this proGXFWZLWKOLTXLGIHUWLOL]HUUHIHUWRWKHODEHOVHFWLRQHQWLWOHG “Compatibility Test for Tank-mix Partners Including Fertilizers” for testing procedures to determine compatibility with the liquid fertilizer product to be used. 9LJRURXVFRQWLQXRXVDJLWDWLRQGXULQJPL[LQJILOOLQJDQGWKURXJKRXWDSSOLFDWLRQLVUHTXLUHGIRUDOOWDQN-mixes. Sparger pipe DJLWDWRUVJHQHUDOO\SURYLGHWKHPRVWHIIHFWLYHDJLWDWLRQLQVSUD\WDQNV7RSUHYHQWIRDPLQJLQWKHVSUD\WDQNDYRLGVWLUULQJ or splashing air into the VSUD\PL[WXUH7RSUHYHQWIRDPLQJGXULQJILOOLQJNHHSHQGRIILO O S LSH EH ORZ WKH VX UID FH RI WKH  liquid in the spray tank. Mixing Order: Fill the spray tank to one-fourth to one-third of the total spray volume required. Start agitation. Add different forPXODWLRQ W\SHVLQ WKH RUGHULQGLFDWHG EHORZ DOORZLQJWLPHIRUFRPSOHWHPL[LQJDQGGLVSHUVLRQDIWHUDGGLWLRQRIHDFK product. Allow extra mixing and dispersion time for dry flowable products. Add different formulation types in the following order: Dry Flowables (DF); Wettable Powders (WP); Aqueous Suspensions (AS); Flowables (F); and Liquids (L). Maintain agitation and fill spray tank to three-fourths of total spray volume. Add this product and other emulsifiable concentrates (EC) and any solutions (S). Fin LVK ILOLQJ WKH VSUD\ WDQN 0DLQWDLQ FRQWLQXRXV DJLWDWLRQ GXULQJ PL[LQJ ILQDO ILOOLQJ DQG WKURXJKRXWDSSOLFDWLRQ,IVSUD\LQJDQGDJLWDWLRQPXVWEHVWRSSHGEHIRUHWKHVSUD\WDQNLVHPSW\WKHPDWHULDOVPD\VHWWOH to the bottom. Settled materials must be resuspended before spraying is resumed. A sparger agitator is particularly useful for this purpose. Settled material may be more difficult to resuspend than when originally mixed. Restrictions: Read and carefully follow all label instructions for each material added to the spray tank. Do not allow water or spray mixture to back siphon into a water source. Pre-mixing: Dry and flowable formulations may be pre-mixed with water (slurried) and added to the spray tank through DWRPHVKVFUHHQ7KLVSURFHGXre assures good initial dispersion of these products in liquid fertilizer or water. Line screen in the spray tank should be no finer than 50 mesh (100 mesh is finer than 50 mesh). Compatibility Test for Tank-mix Partners Including Liquid Fertilizers If compatibility of this product with the tank-mix partner is not knownperform a jar test prior to tank-mixing this product with other pesticides or liquid fertilizer to ensure compatibility. Use a clear glass quart jar with lid and mix the tank-mix Drexel Trifluralin 4EC Herbicide, EPA Reg. 19713-254, Rev. October 9, 2024, Page 6 of 57 ingredients in their relative proportions and in the order indicated in the tank-mixing section above. Invert the jar containing WKHPL[WXUHVHYHUDOWLPHVDQGREVHUYHWKHPL[WXUHIRUDSSUR[LPDWHO\PLQXWHV,IFRPSRQHQWVRIWKHPL[WXUHVHSDUDWH UHDGLO\DFRPSDWLELOLW\DJHQWPD\EHKHOSIXOLQPDLQWDLQLQJWKHVWDELOLW\RIWKHVSUD\PL[WXUH,IWKHPL[WXUHEDOOVXSIRUPV IODNHVVOXGJHJHOVRLO\ILOPVRUOD\HUVRURWKHUSUHFLSLWDWHVWKHFRPSRQHQWVRIWKHPL[WXUHDUHQRWFRPSDWLEOHDQGIXOO- scale tank-mixing should not be attempted. Note: &RPSOLDQFH ZLWK 6WDWH UHJXODWLRQV IRU OLTXLG IHUWLOL]HU PL[LQJ UHJLVWUDWLRQ ODEHOLQJ DQG DSSOLFDWLRQ DUH WKH responsibility of the individual and/or company offering the fertilizer or chemical mixture for sale. ROTATION CROP RESTRICTIONS SUGAR BEETS, RED BEETS AND SPINACH (AZ, CA, CO, ID, MT, NM, NV, OR, UT, WA and WY): Do not plant Red EHHWV6XJDUEHHWVRU6SLQDFKIRUPRQWKVDIWHUD6SULQJDSSOLFDWLRQRUPRQWKVDIWHUD)DOODSSOLFDWLRQRIWKLVSURGXFW Plowing to a depth of 12 inches prior to planting these crops will reduce the possibility of crop injury. If land has not been LUULJDWHGdo not plant these crops 18 months after a Spring application or 20 months after a Fall application of this product. All Other Areas: Do not plant 5HGEHHWV6XJDUEHHWVDQG6SLQDFKIRUPRQWKVDIWHUD6SULQJDSSOLFDWLRQRUPRQWKV DIWHUD)DOODSSOLFDWLRQ%HIRUHSODQWLQJ6XJDUEHHWVPROGERDUGSORZWRDGHSWKRILQFKHVWRUHGXFHWKHSRVVLELOLW\RI crop injury. PROSO MILLET, CORN, SORGHUM (MILO), OATS AND ANNUAL OR PERENNIAL GRASS CROPS OR GRASS MIXTURES (AZ, CA, CO, ID, MT, NM, NV, OR, UT, WA and WY): Do not plant 3URVRPLOOHW&RUQ6RUJKXP 0LOR 2DWV and Annual or Perennial grass crops or grass mixtures for 12 months after a Spring application or 14 months after a Fall DSSOLFDWLRQRIWKLVSURGXFW,IODQGKDVQRWEHHQLUULJDWHG do not plant these crops for 18 months after a Spring application or 20 months after a Fall application. Moldboard plowing to a depth of 12 inches before planting these crops will reduce the possibility of crop injury. (MN, ND and SD): Do not plant 3URVRPLOOHW6RUJKXP 0LOR 2DWVDQGDQQXDORUSHUHQQLDOJUDVVFURSVRUJUDVVPL[WXUHV for 18 months after a spring application or 21 months after a fall application of this product. Portions of KS, NE, OK and TX that receive less than 20 inches of rainfall and irrigation to produce a crop: Do QRWSODQW3URVRPLOOHW6RUJKXP 0LOR 2DWVDQG$QQXDORU3HUHQQLDOJrass crops or grass mixtures for 18 months after DQDSSOLFDWLRQRIWKLVSURGXFW,Q6RUJKXPFRROZHWZHDWKHUFRQGLWLRQVGXULQJHDUO\JURZWKVWDJHVPD\LQFUHDVHWKH possibility of crop injury. In all other areas receiving more than 20 inches of rainfall and irrigation: Do not plant 3URVRPLOOHW6RUJKXP 0LOR  2DWVDQGDQQXDORUSHUHQQLDOJUDVVFURSVRUJUDVVPL[WXUHVIRU12 months after a Spring application or 14 months after a Fall application of this product. OTHER CROPS Do not plant vegetable crops other than those to which this product may be applied as a pre-plant soil incorporated treatment within 5 months after an application of this product. SOIL TEXTURE GUIDE FOR APPLICATION RATES Rates specified for incorporated treatments of this product are based on “Soil Texture Class” (Coarse, Medium or Fine) and soil organic matter content. A Fine textured soil HJClay loam) will require a higher application rate than a Coarse textured soil HJLoamy sand ). In the following table  ILQG WKH“Soil Texture Class” (Coarse, Medium or Fine ) corresponding to the “Soil Texture to be Treated”. Choose the proper rate for each application based on the “Soil Texture Class” and specific crop directions. Do not exceed specified rates. Soil Texture Class Soil Texture to be Treated Coarse (Light) soils 6DQG/RDP\VDQG6DQG\ORDP Medium soils /RDP6LOW\FOD\ORDP 6LOWORDP6LOW6DQG\FOD\ORDP Fine (Heavy) soils &OD\&OD\ORDP6LOW\FOD\ORDP 6LOW\FOD\6DQG\FOD\6DQG\FOD\ORDP Drexel Trifluralin 4EC Herbicide, EPA Reg. 19713-254, Rev. October 9, 2024, Page 7 of 57 *Silty clay loam and Sandy clay loam soils are transitional soils and may be classified as either Medium or Fine textured VRLOV,I6LOW\FOD\ORDPRU6DQG\FOD\ORDPVRLOVDUHSUHGRPLQDQWO\6DQGRU6LOWWKH\DUHXVXDOO\FODVVLILHGDV0HGLXP textured sRLOV,IWKH\DUHSUHGRPLQDQWO\&OD\WKH\DUHXVXDOO\FODVVLILHGDV)LQHWH[WXUHGVRLOV APPLICATION METHODS $VVSUD\YROXPHGHFUHDVHVWKHLPSRUWDQFHRIDFFXUDWHFDOLEUDWLRQDQGXQLIRUPDSSOLFDWLRQLQFUHDVHV&KHFNFDOLEUDWLRQ and uniformity of spray DSSOLFDWLRQGDLO\7RDYRLGVSUD\GULIWGRQRWDSSO\ZKHQZLQGVDUHJXVWLQJRUZKHQZLQGVSHHG is greater than 15 mph. Ground Broadcast Application $SSO\WKLVSURGXFWLQWRJDOORQVRIOLTXLGFDUULHUSHUDFUH EURDGFDVWEDVLV XVLQJDQ\SURSHUO\FDOLEUDWHGORZSUHVVXUH herbicide sprayer that will apply the spray uniformly. The carrier may be water or liquid fertilizer as specified for the crop to be treated in the “CROPS” VHFWLRQ RI WKLV ODEHO )RU EDQG DSSOLFDWLRQ DGMXVW KHUELFLGH UDWH DQG VSUD\ Yolume in proportion to the band width and row width treated. Aerial Broadcast Application $SSO\WKLVSURGXFWLQWRJDOORQVRIZDWHUSHUDFUH$GMXVWSXPSSUHVVXUHQR]]OHDUUDQJHPHQWVVSHHGDQGDSSOLFDWLRQ height to provide uniform application to the soil surface. Use swath markers or flaggers to assure proper swath width interval. Application with Dry Bulk Fertilizer Dry bulk fertilizers impregnated or coated with this product may be applied as a pre-plant incorporated treatment on listed crops. Follow aOOODEHOGLUHFWLRQVIRUWKLVSURGXFWUHJDUGLQJDSSOLFDWLRQUDWHVLQFRUSRUDWLRQGLUHFWLRQVVSHFLDOLQVWUXFWLRQV and precautions. Read and follow all label instructions below concerning use of this product with dry bulk fertilizer. Properly applied dry bulk fertilizers impregnated with this product provides weed and grass control equal to water sprays. Use the following formula to calculate the amount of this product required to impregnate a ton of dry bulk fertilizer. Pints RI7KLV3URGXFW3HU$FUH;1000 Lbs. of Fertilizer = Quarts of This Product per Ton of Fertilizer Acre Limitations: Apply a minimum of 200 pounds per acre of dry fertilizer impregnated with this product at the specified broadcast rate per acre. Any commonly used dry fertilizer can be used for impregnation of this product except coated ammonium nitrate and pure limestone. These materials will not absorb the herbicide. Blends containing mixtures of these materials can be impregnated. Impregnation: 8VH DQ\ FORVHG GUXPEHOWULEERQ RURWKHU FRPPRQO\ XVHG GU\ EXON IHUWLOL]HU EOHQGHU 1R]]OHV XVHG WR apply this product to dry bulk fertilizer should be placed to provide uniform spray coverage. Application and Incorporation: Spread the fertilizer/chemical mixture with properly calibrated application equipment. Be certain the material is applied uniformly to the soil surface. This product should be incorporated 2 times when impregnated on dry bulk fertilizer. The first incorporation should occur within 24 hours after application. The second LQFRUSRUDWLRQVKRXOGEHGHOD\HGWRGD\VDIWHUWKHILUVWDQGEHFRPSOHWHGSULRUWRSODQWLQJ Compliance with State Regulations: Compliance ZLWK 6WDWH UHJXODWLRQV UHODWLQJ WR GU\ EXON IHUWLOL]HU EOHQGLQJ UHJLVWUDWLRQ ODEHOLQJ DQG DSSOLFDWLRQ DUH WKH UHVSRQVLELOLW\ RI WKH LQGLYLGXDO DQGRU FRPSDQ\ RIIHULQJ WKH IHUWLOL]HU RU chemical mixture for sale. Application by Chemigation This product may be applied through properly equipped chemigation systems for weed control in certain crops as specified in the “CROPS” section of this label. Read and follow all label instructions outlined below concerning chemigation before applying this product by this method. Drexel Trifluralin 4EC Herbicide, EPA Reg. 19713-254, Rev. October 9, 2024, Page 8 of 57 Chemigation Directions: Apply this product only through VSULQNOHU LQFOXGLQJPLFURFHQWHUSLYRWHQGWRZVLGH>ZKHHO@ UROO WUDYHOHU VROLG VHW ODWHUDO PRYH KDQG PRYH  IORRG EDVLQ  IXUURZ ERUGHU FKHPLJDWLRQ VRLO GUHQFK XVHV  RU GULS (including surface and subsurface) irrigation systems. Do not apply this product through any other type of irrigation system. Do not apply this product in an irrigation system connected to a public water supply. Public water supply means a system for the provision to the public of piped water for human consumption if such system has at least 15 service FRQQHFWLRQVRUUHJXODUO\VHUYHVDQDYHUDJHRIDWOHDVWLQGLYLGXDOVGDLO\DWOHDVWGD\VRXWRIWKH\HDU &URSLQMXU\ODFNRIHIIHFWLYHQHVVRULOOHJDOSesticide residues in the crop can result from non-uniform distribution of treated ZDWHU ,I \RX KDYH DQ\ TXHVWLRQV DERXW FDOLEUDWLRQ \RX VKRXOGFRQWDFW 6WDWH H[WHQVLRQ VSHFLDOLVWV HTXLSPHQW manufacturers or other experts. Do not connect an irrigation system (including greenhouse systems) used for pesticide application to a public water system. A person knowledgeable of the chemigation system and responsible for its operation or under the supervision of the responsible person shall shut the system down and make necessary adjustments should the need arise. Irrigation System Directions: 1. 7KHV\VWHPPXVWFRQWDLQDIXQFWLRQDOFKHFNYDOYHYDFXXPUHOLHIYDOYHDQGORZSUHVVXUH drain appropriately located on the irrigation pipeline to prevent water source contamination from back-flow. 2. 7KHSHVWLFLGHLQMHFWLRQSLSHOLQHPXVWFRQWDLQDIXQFWLRQDODXWRPDWLFTXLFN-closing check valve to prevent the flow of fluid back toward the injection pump.  7KHSHVWLFLGHLQMHFWLRQSLSHOLQHPXVWDOVRFRQWDLQDIXQFWLRQDOQRUPDOO\FORVHGVROHQRLG-operated valve located on the intake side of the injection pump and connected to the system interlock to prevent fluid from being withdrawn from the supply tank when the irrigation system is either automatically or manually shut down. 4. The system must contain functional interlocking controls to automatically shut off the pesticide injection pump when the water pump motor stops. 5. The irrigation line or water pump must include a functional pressure switch which will stop the water pump motor when the water pressure decreases to the point that pesticide distribution is adversely affected.  6\VWHPV PXVW XVH D PHWHULQJ SXPS VXFK DV D SRVLWLYH GLVSODFHPHQW LQMHFWLRQ SXPS HJ GLDSKUDJP SXPS  effectively designed and constructed of materials that are compatible with pesticides and capable of being fitted with a system interlock. Directions for All Irrigation Systems: 1. Do not allow contact with crop foliage or fruit unless prescribed on the label. 2. Do not apply when wind speed favors drift beyond the area intended for treatmentZKHQV\VWHPFRQQHFWLRQVOHDNRU when emitters do not provide uniform distribution. %HIRUHXVHUHPRYHVFDOHVSHVWLFLGHUHVLGXHVDQGRWKHUGHEULVIURPWKHPL[WDQNDQGWKHSXPSV\VWHP)OXVKV\VWHP with clean water. 4. Calibration and distribution will be more accurately achieved by injecting a larger volume of a more dilute solution over WLPH,IGHVLUHGGLOXWHWKLVSURGuct with water prior to injection and mix solution sufficiently to ensure uniform delivery into the injection system. Maintain adequate agitation. 5. Sprinkler systems should be calibrated to deliver a volume of 4 to 50 gallons per hour (gph) per emitter. Apply this product in overhead irrigation equal to 0.5 to 1 inch of water. 'ULSV\VWH PVVKRXOGEHVHWDWWRJSK per emitter. The application interval should be such that at one period of WLPHGXULQJWKHLQMHFWLRQWKHILUVWDQGODVWHPLWWHUVLQWKHV\VWHPFRQWDLQZDWHUWUHDWHGZLWKWKLVSURGXFW  $IWHU DSSOLFDWLRQ LV FRPSOHWHG IOXVK HTXLSPHQW ZLWK FOHDQ ZDWHUWhen continue to irrigate for one to two hours. 8. Mechanical soil incorporation is not required when this product is applied through chemigation systems. For Application of This Product Through Irrigation Systems for Overall Weed Control (Broadcast): 1. UVHVSULQNOHUV\VWHPV PLFURFHQWHUSLYRWHQGWRZVLGH ZKHHO UROOWUDYHOHUVROLGVHWODWHUDOPRYHDQGKDQGPRYH  flood EDVLQ  IXUURZ DQG ERUGHU FKHPLJDWLRQ VRLO GUHQFK XVHV  WR DSSO\ WR FURSV ZKLFK SHUPLW DSSOLFDWLRQ E\ chemigation on this label. 2. Inject this product continuously throughout the chemigation period. &KHFNSHULRGLFDOO\Whe chemigation metering pump during application to ensure proper operation. 4. The injection metering pump must be calibrated as specified by the manufacturer. 'XULQJFKHPLJDWLRQPDLQWDLQDJLWDWLRQDWDOOWLPHV Drexel Trifluralin 4EC Herbicide, EPA Reg. 19713-254, Rev. October 9, 2024, Page 9 of 57 7. Apply label-prescribed rates to treated area only. If the irrigation system does not apply treated water to the entire area RIWKHILHOGDGMXVWWKHDPRXQWRI this product used to match the DFWXDOWUHDWHGDFUHDJH sq. ft. = 1 acre) For Control of Break-Through Weeds (including foliage, root, rhizome, or stolon) at Irrigation (Emitter) Points: Use drip systems (surface and sub-VXUIDFH DQGVSULQNOHUV\VWH PV PLFURVROLGVHWDQGKDQGPRYH WRDSSO\WRFURSV which permit DSSOLFDWLRQE\FKHPLJDWLRQRQWKLVODEHO,QWKLVDSSOLFDWLRQUDWHV of this product which are listed as broadcast rates should be prorated to treat only the desired soil area. Do not apply this product in this manner more than times per calendar year. x Surface drip and sprinkler applications - (Timing): lnject this product at the end of the irrigation cycle allowing 1 to 1.5 hours of irrigation following the application to flush lines with clear water. (Rate Calculation): FoUH[DPSOH apply 2 to 4 pints of this product per acre to the treated area. A treated acre is defined as the surface area wetted by the irrigation system. 7RFDOFXODWHWKHWUHDWHGDFUHDJHPXOWLSO\WKHQXPEHURIHPLWWHUVLQDQLUULJDWLRQVHW by WKHPHDVXUHGVTXDUHIRRWDJHRIWKHZHWWHGDUHDRIWKHDYHUDJHHPLWWHUGLYLGHGE\ x Sub-surface drip applications - (Timing): Charge the irrigation system. Begin application of this product immediately after all emitter points are functional. Shut off the irrigation system immediately following completion of application of this productDOORZLQJWKis product to bond to the treated soil. Resume irrigation 4 to 8 hours after application of this product. (Rate Calculation): )RUH[DPSOHDSSO\WRSLQWVRIthis product per treated acre. The treated acreage is defined as the square footage area wetted by the irrigation system during the application period. Multiply W K H Q X P E H U R I H PL W W H U V  I R U  O H D N \ K R V H  W \ S H R I V \ V W H P  X V H W KH OLQHDU feet of buried line) per irrigation set by the desired square footage to be treated around each emitter and divide by ,QWKLVW\SHRI DSSOLFDWLRQLWLVXVXDOO\GHVLUDEOHWRWreat only 2 to 4 square inches around each irrigation emitter in order to prevent break-through weeds. Note: Application of this product through irrigation systems as a supplemental weed control practice to suppress break- through weeds including pest IROLDJHURRWVDQGUKL]RPHVDWLUULJDWLRQHPLWWHUVZLOOLQKLELWWKHIRUPDWLRQRIURRWWLVVXHs . Improper use of this product may result in yield loss due to weak or deformed root structure in annual and some perennial crops. Make injections of this product after the majority of the root development has occurred but prior to pest presence in the emitter zone. Visual inspection of the root zone is necessary for proper application timing. Injections of this product should be done separately from normal irrigaWLRQSUDFWLFHV)RUDQQXDOFURSVZLWKWDSRUEXOEW\SHURRWVWUXFWXUHEXU\WKHGULSOLQHRII center of the planted row or below the depth of the fully developed tap root or bulb. Injections of this product made early in the crop development or in shallow buried drip lines will result in restricted root development and possible yield loss. &RQVXOW\RXUORFDO)DUP$GYLVRU3&$RU0DQXIDFWXUHUIRUSURSHUXVHRIWKLVSURGXFW Chemigation System Calibration (Sample Calculation for Use of This Product in a Chemigation System): $VVXPH LQWKLVH[DPSOHDFUHVDUHWREHFRYHUHGE\DFKHPLJDWLRQWUHDWPHQW3URGXFWUHTXLUHGDVVXPLQJSLQWVSHUDFUH LVSLQWV DFUHV[SWVSHUDFUH SWV JDOV $GGJDOORQVRISURGXFWdirectly to the injection VXSSO\WDQN$GMXVWWKHLQMHFWLRQV\VWHPWRGHOLYHUJDOORQVGXULQJWKHWLPHUHTXLUHGWRDSSO\LQFKRIZDWHUWR acres. ,IWKHLUULJDWLRQV\VWHPUHTXLUHVKRXUVWRDSSO\LQFKRIZDWHUWRDFUHVWKHLQMHFWLRQUDWHLV 1.25 gallons per hour and is calculated as follows: 25 gals. ÷ 20 hours = 1.25 gals. per hour JDOVSHUKRXU IOR]VSHUKRXU Proper calibration requires the injection pump to be adjusted to deliver 2.7 fl. ozs. per minute and is calculated as follows: IOR]VSHUKRXU·PLQXWHVSHUKRXU IOR]VSHUPLQXWH Drexel Trifluralin 4EC Herbicide, EPA Reg. 19713-254, Rev. October 9, 2024, Page 10 of 57 Chemigation Mixing Directions Undiluted: :KHQXVHGDORQHWKHLQMHFWLRQRIXQGLOXWHGSURGXFWLVUHFRPPHQGHGLQFKHmigation systems. For undiluted XVHWKHPHWHULQJSXPSVXSSO\WDQNDQGDQ\DVVRFLDWHGHTXLSPHQWPXVWEHWKRURXJKO\FOHDQDQGGU\EHIRUHWKLVSURGXFW LVDGGHGWRWKHV\VWHPIRULQMHFWLRQ:KHQLQMHFWLQJXQGLOXWHGSURGXFWPDLQWDLQFRQWLQXRXVDJLWDWLRQLQWhe supply tank. Diluted: This product may be diluted if required to achieve accurate calibration for existing equipment. Partially fill the injection supply tank with a volume of water equal to the amount of this product required (Do not add water to this product). Start agitation. Add the required amount of this product to water in the supply tank and continue mixing while filling the WDQNWRWKHILQDOYROXPHUHTXLUHGE\WKHLQMHFWLRQSXPSFDOLEUDWLRQ:KHQLQMHFWLQJGLOXWHGSURGXFWPDLQWDLQFRQWLQXRXV agitation in supply tank. APPLICATION TIMING Spring Application: Apply and incorporate this product any time after January 1 when soil can be worked and is in a condition which allows thorough mixing to ensure uniform incorporation. See “CROPS” section for application timing and directions for specified crops. Fall Application: Fall application can be used for all crops for which this product is specified as a pre-plant incorporated treatment. Refer to “CROPS” section for any crop specific Fall application instructions. In the States of California  Minnesota 1orth Dakota and South Dakota apply and incorporate this product any time between September 1 and 'HFHPEHU,QDOORWKHU6WDWHV)DOODSSO\WKLVSURGXFWEHWZHHQ2FWREHUDQG'HFHPEHU*URXQGPD\EHEHGGHG XSRYHU:LQWHU2QEHGGHGJURXQGUHGXFHEHGVWRGHVLUHGKHLJKWEHIRUHSODQWLQJE\PRYLQJVRPHWUHDWHGVRLOIURPEHGV LQWRIXUURZV:KHUHVRLOLVOHIWIODWRYHU:LQWHUFDUHVKRXOGEHWDNHQQRWWRWXUQXSXQWUHDWHGVRLOGXULQJ6SULQJEHGGLQJ operations. Destroy established weeds during seedbed preparation. Weeds established in furrows as a result of exposing untreated soil should be destroyed before planting. Do not make Fall application on fields which remain wet or subject to periods of flooding. Pre-emergence Application Immediately After Planting: Apply and incorporate this product immediately after planting and prior to crop germination. Adjust incorporation equipment so as not to disturb planted seed. Refer to the “CROPS” section of this label for crop specific instructions. Post-emergence and Lay-by Application: Apply and incorporate this product at the specified rate to the established crop at or before the last cultivation. Required pre-harvest intervals for treatments with this product for certain crops are specified in the “CROPS” section of this label. Crop cover may prevent uniform soil coverage from over-the-top sprays. 7RDYRLGWKLVSUREOHPXVHGURSQR]]OHVRUGLUHFWHGVSUD\VWRDFKLHYHXQLIRUPVRLOFRYHUDJH INCORPORATION DIRECTIONS Soil Preparation and Incorporation: *URXQGFRYHUVXFKDVFURSUHVLGXHVRUH[LVWLQJZHHGVFDQLQWHUIHUHZLWKXQLIRUP VRLOLQFRUSRUDWLRQRIWKLVSURGXFW$PDQDJHDEOHOHYHORIJURXQGFRYHUZLOODOORZXQLIRUPLQFRUSRUDWLRQLQWRWKHWRSWR LQFKHV RI VRLO *URXQG FRYHU DQG FURS UHVLGXHV LI H[FHVVLYH VKRXOG EH UHGXFHG E\ DSSURSULDWH VRLO WLOODJH SULRU WR application. Break up clods using tillage equipment prior to application of this product. Soil Incorporation: This product must be incorporated within 24 hours after application by either mechanical incorporation or at OHDVW  DFUH LQFK RI ZDWHU UDLQIDOORULUULJDWLRQ ,I D VHFRQG LQFRUSRUDWLRQLVQHHGHG LW VKRXOG EH GHOD\HGWRGD\VDIWHUWKHILUVWLQFRUSRUDWLRQDQGEHFRPSOHWHGSULRUWRSODQWLQJ With most equipment and me WKRGV RI DSSOLFDWLRQ D VHFRQG LQFRUSRUDWLRQLV UHTXLUHG DQGPD\ RFFXU DQ\ WLPH EHIRUH SODQWLQJ7KHVHFRQGLQFRUSRUDWLRQVKRXOGEHLQDGLIIHUHQWGLUHFWLRQDQGWRDYRLGEULQJLQJXQWUHDWHGVRLOWRWKHVXUIDFH should not be deeper than the first. Note: Two-pass incorporation is required for all special use programs unless otherwise specified. Soil Conditions: The soil surface should be smooth enough to allow for uniform application and efficient incorporation of this product. Apply when soil moisture is sufficient to allow the breakup of large clods and uniform mixing during the incorporation process. Soil compaction and/or non-uniform incorporation may occur if soil is excessively moist. Drexel Trifluralin 4EC Herbicide, EPA Reg. 19713-254, Rev. October 9, 2024, Page 11 of 57 Incorporation in Bedded Culture: ,QEHGGHGFXOWXUHWKLVSURGXFWVKRXOGEHLQFRUSRUDWHGWRDGHSWKRIWRLQFKHVLQ the final seedbed. Application Prior to Bedding: Apply this product and incorporate one time with recommended equipment. The bedding operation serves as the second incorporation. Do not expose untreated soil during post-bedding operations such as planting since removal of treated soil during planting can allow weed germination and establishment in the drill row. Application After Bedding: .QRFNRIIEHGVWRSODQWLQJKHLJKWEHIRUHDSSO\LQJWKLVSURGXFW$SSO\DQGLQFRUSRUDWHWKLV product with recommended equipment that will conform to the shape of the bed. Do not expose untreated soil. Cultivation After Planting: Treated crops may be shallowly cultivated without reducing the weed control activity of this SURGXFW/LPLWGHSWKRIFXOWLYDWLRQWRWKH]RQHRIWUHDWHGVRLO WRLQFKHV WRDYRLGPRYLQJXQWUHDWHG soil to the surface. Exposure of untreated soil may cause loss of weed control. INCORPORATION EQUIPMENT 8VHLQFRUSRUDWLRQHTXLSPHQWFDSDEOHRIPL[LQJWKLVSURGXFWXQLIRUPO\LQWRWKHWRSWRLQFKHVRIWKHILQDOVHHGEHG8VH of inappropriate equipment or improper use of recommended equipment may result in erratic weed control and/or crop injury. Incorporation equipment such as a tandem disc will mix this product approximately half as deep as the equipment LVVHWWRRSHUDWH)RUH[DPSOHDGLVFVHWWRFXW 4 inches deep will mix most of this product within the top 2 inches of soil. Any recommended incorporation implement may be used alone or in combination with any other recommended implement. Two incorporation passes are required unless otherwise specified. Tandem Disc: 6HWHTXLSPHQWWRFXWWRLQFKHVGHHSDQGRSHUDWHDWWRPSK Field Cultivator: 6HWHTXLSPHQWWRFXWWRLQFKHVGHHSDQGRSHUDWHDWDPLQLPXPRIPSK$ILHOGFXOWLYDWRULVGHILQHG DVDQLPSOHPHQWZLWKWRURZVRIVZHHSVVSDFHGDWLQWHUYDOVRILQFKHVRUOHVVDQGVWDJJHUHGVRWKDWQRVRLOLVOHIW unturned. Chisel points should not be used. Combination Seedbed Conditioners: These implements are defined as two or more tillage devices combined to operate DVDVLQJOHWLOODJHXQLW)RUH[DPSOHWRURZVRIILHOGFXOWLYDWRU&- or S- shaped shanks with an effective sweep spacing RIWRLQFKHV VWDJJHUHGVRWKDWQRVRLOLVOHIWXQWXUQHG IROORZHGE\DVSLNH-WRRWKRUIOH[WLQHKDUURZIROORZHGE\D JURXQGGULYHQUHHORUEDVNHW&RPELQDWLRQLPSOHPHQWVVKRXOGEHVHWWRFXWWRLQFKHVGHHSDQGRSHUDWHGDWDPLQLPXP RI  PSK 7Kis product can be incorporated with one pass when using a combination seedbed conditioner. Two LQFRUSRUDWLRQVDUHUHTXLUHGXQGHUFRQGLWLRQVZKLFKSUHYHQWRSWLPXPVRLOPL[LQJVXFKDVH[FHVVLYHWUDVKURXJKQHVVKLJK clay content or soil moisture. Rolling Cultivator: 6HWHTXLSPHQWWRFXWWRLQFKHVGHHSDQGRSHUDWHDWWRPSK*HQHUDOO\UROOLQJFXOWLYDWRUVDUH adequate for use only on Coarse and Medium soils,Q6XJDUFDQHWKHUROOLQJFXOWLYDWRUPD\EHXVHGRQFine textured soils. Bed Conditioner (Do-All): 6HWHTXLSPHQWWRFXWWRLQFKHVGHHSDQGRSHUDWHDWWRPSK2QHLQFRUSRUDWLRQSDVV LVDGHTXDWHLQEHGGHGFXOWXUHZKLOHWZRLQFRUSRUDWLRQSDVVHVDUHUHTXLUHGLQIODWSODQWHGFXOWXUH7KHGR-all should be used only on Coarse and Medium textured soils. Mulch Treader and other similar Disc-type Implements: 6HWHTXLSPHQWWRFXWWRLQFKHVGHHSDQGRSHUDWHDWWR 8 mph. Other Equipment: Other implements including the flexible fine-WRRWKKDUURZ )OH[WLQHRU0HOURH DUHUHFRPPHQGHGEXW only for certain uses defined in the “CROPS” section of this label. Conservation Tillage Practices:௖,QUHGXFHGRUPLQLPXPWLOODJHVLWXDWLRQV)DOORU6SULQJDSSOLFDWLRQDQGLQFRUSRUDWLRQ of this product may be combined with tillage operations. The first incorporation may utilize equipment such as a tandem GLVFFRPELQDWLRQLPSOHPHQWRUEHGGLQJHTXLSPHQWWKDWSURYLGHVJRRGVRLOPL[LQJEXWOHDYHVDPD[LPXPDPRXQWRIFURS Drexel Trifluralin 4EC Herbicide, EPA Reg. 19713-254, Rev. October 9, 2024, Page 12 of 57 residue on the soil surface. The second incorporation may be accomplished with tillage equipment that provides uniform soil mixing used in conjunction with no-till planters. (See specific directions for reduced or conservation tillage situations for Cotton and Soybeans in the “CROPS” section.) Single Pass Incorporation Option This product may be incorporated in a single pass if incorporation conditions allow for thorough and uniform mixing into WKHWRSWRLQFKHVRIWKHILQDOVHHGEHG7KRURXJKDQGXQLIRUPLQFRUSRUDWLRQPD\EHDFKLHYHGLIWKHVRLODWWKHWLPHRI incorporation is of food tilth ZLWKPRGHUDWHPRLVWXUHDQGLVUHODWLYHO\IUHHRIFORGVDQGFURSUHVLGXH The following types of equipment can be used to obtain thorough and uniform soil mixing from a single incorporation pass: Finishing disc ZLWKGLVFEODGHVQRJUHDWHUWKDQLQFKHVLQGLDPHWHUVSDFHGQRPRUHWKDQLQFKHVDSDUW2SHUDWH DWWRPSK%HVWUHVXOWVDUHREWDLQHGZKHQWKHGLVFLVHTXLSSHGZLWKKDUURZUHHORUEDVNHWDWWDFKPHQWV Field Cultivator: 6HWHTXLSPHQWWRFXWWR inches deep and operate at a minimum of 5 mph. A field cultivator is defined DV DQLPSOHPHQW ZLWK  WR  URZV RI VZHHSV VSDFHG DWLQWHUYDOVRILQFKHVRUOHVVZLWKVZHHSVRQVXFFHVVLYHURZV staggered so that no soil is left unturned. Chisel points should not be used. Best results are obtained when the field FXOWLYDWRULVHTXLSSHGZLWKKDUURZUHHORUEDVNHWDWWDFKPHQWV Combination Implements: These implements are defined as 2 or more tillage devices combined to operate as a single tillage unit. For exaPSOHWRURZVRUILHOGFXOWLYDWRU&- or S-shaped shanks with successive rows of sweeps staggered VR WKDW QR VRLO LV OHIW XQWXUQHG IROORZHG E\ D VSLNH-WRRWK RU IOH[WLQH KDUURZ IROORZHG E\ JURXQG GULYHQ UHHO EDVNHW RU incorporator wheels. Combination LPSOHPHQWVVKRXOGEHVHWWRFXWWRLQFKHVGHHSDQGRSHUDWHGDWDPLQLPXPRI PSK 7ZR LQFRUSRUDWLRQV DUH UHFRPPHQGHG XQGHU FRQGLWLRQV ZKLFKSUHYHQW RSWLPXP VRLO PL[LQJ VXFK DV H[FHVVLYH VXUIDFHUHVLGXHURXJKQHVVKLJKFOD\FRQWHQWRUVRLOLVWRRZHt or too dry. Combination tools can also be composed of 2 rows of wide crown sweeps that overlap so that the roots of all weeds and plants are severed. This should be followed by 2 gangs of rotating spoked wheels that thoroughly mix this product into the tRSWRLQFKHVRIWKHILQDOVHHGEHG P.T.O. Driven Equipment (tillers, cultivators, hoes): $GMXVWHTXLSPHQWWRLQFRUSRUDWHWKLVSURGXFWLQWRWKHWRSWR inches of the final seedbed with rotor spaced to provide a clean sweep of the soil. P.T.O. equipment should not be operated more than 4 mph. WEEDS CONTROLLED BY THIS PRODUCT GRASS WEEDS Common Name Scientific Name Annual bluegrass Poa annua Barnyardgrass (Watergrass) Echinochloa crus-galli Brachiaria (Signalgrass) Brachiaria spp. Bromegrass &KHDWJUDVV'RZQ\EURPH Bromus tectorum Cheat (Chess) Bromus secalinus &UDEJUDVV /DUJHFUDEJUDVV6PRRWKFUDEJUDVV Digitaria spp. )R[WDLO %RWWOHJUDVV%ULVWOHJUDVV*LDQWIR[WDLO*UHHQIR[WDLO )R[WDLOPLOOHW3LJHRQJUDVV5REXVWIR[WDLO 5 gallons up to < 250 gallons): Nonrefillable container. Do not reuse or UHILOOWKLVFRQWDLQHU2IIHUIRUUHF\FOLQJLIDYailable. Clean container promptly after emptying. Triple rinse as follows: Empty the remaining contents into application equipment or a mix tank. Fill the container one-fourth full with water. 5HSODFH DQG WLJKWHQ FORVXUHV 7LS FRQWDLQHU RQ LWV VLGH DQG UROO LW EDFN DQG IRUWK HQVXULQJ DW OHDVW RQH FRPSOHWH UHYROXWLRQIRUVHFRQGV6WDQGWKHFRQWDLQHURQLWVHQGDQGWLSLWEDFNDQGIRUth several times. Turn the container over onto its other end and tip it back and forth several times. Empty the rinsate into application equipment or a mix tank or store rinsate for later use or disposal. Repeat this procedure two more times. Dispose of empty container in a VDQLWDU\ODQGILOORUE\LQFLQHUDWLRQRULIDOORZHGE\6WDWHDQGORFDODXWKRULWLHVE\EXUQLQJ,IEXUQHGVWD\RXWRIVPRNH 5 H I L O O D E O H & R Q W D L Q H U  •    J D O O R Q V  % X O N  Refillable container. Refill this container with pesticide only. Do not reuse this container for any other purpose. Cleaning the container before final disposal is the responsibility of the person disposing of the container. Cleaning before refilling is the responsibility of the refiller. To clean the container before fiQDOGLVSRVDOHPSW\WKHUHPDLQLQJFRQWHQWVIURPWKLVFRQWDLQHULQWRDSSOLFDWLRQHTXLSPHQWRUPL[WDQN)LOOWKH container about 10% full with water. Agitate vigorously or recirculate water with the pump for 2 minutes. Pour or pump rinsate into application equipment or rinsate collection system. Repeat this rinsing procedure two more times. 7KHQRIIHUIRUUHF\FOLQJLIDYDLODEOHRUUHFRQGLWLRQLQJLIDSSURSULDWHRUSXQFWXUHDQGGLVSRVHRILQDVDQLWDU\ODQGILOORU by other procedures approved by state and local authorities.