crop-chem-docs/corpus/epa_ppls/279-9587.md

AVAUNT INSECTICIDE

• EPA Reg No: 279-9587
• Registrant: FMC CORPORATION
• Signal word: Caution
• Active ingredients: Indoxacarb (30%)
• Label accepted: 2025-11-21
• Source PDF: https://www3.epa.gov/pesticides/chem_search/ppls/000279-09587-20251121.pdf

---

November 21, 2025

Kristi Barnett Product Registration Specialist FMC Corporation c/o FMC Stine Research Center P.O. Box 30 Newark, Delaware 19714-0030

Subject: Label Amendment - Registrati on Review Mitigation for Indoxacarb Product Name : AVAUNT INSECTICIDE EP A Registration Number: 279-9587 Case Number: 475983 Application Dates: June 27, 2019

Dear Kristi Barnett:

The Agency, in accordance with the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA), as amended, has completed reviewing all the information submitted with your application to support the Registration Review of the above referenced product in connection with the Indoxacarb Interim Decision, and has concluded that your submission is acceptable. The label referred to above, submitted in connection with registration under FIFRA, as amended, is acceptable.

Should you wish to add/retain a reference to the company’s website on your label, then please be aware that the website becomes labeling under the Federal Insecticide, Fungicide, and Rodenticide Act and is subject to review by the Agency. If the website is false or misleading, the product would be misbranded and unlawful to sell or distribute under FIFRA section 12(a)(1)(E). 40 CFR 156.10(a)(5) list examples of statements EPA may consider false or misleading. In addition, regardless of whether a website is referenced on your product’s label, claims made on the website may not substantially differ from those claims approved through the registration process. Therefore, should the Agency find or if it is brought to our attention that a website contains false or misleading statements or claims substantially differing from the EPA approved registration, the website will be referred to the EPA’s Office of Enforcement and Compliance Assurance.

A stamped copy of your labeling is enclosed for your records. This labeling supersedes all previously accepted labeling and must be used at your next label printing. You must

Page 2 of 2 EPA Reg. No. 279-9587 Case No. 475983

submit one copy of the final printed labeling before you release the product for shipment with the new labeling. In accordance with 40 CFR 152.130(c), you may distribute or sell this product under the previously approved labeling for 12 months from the date of this letter. After 12 months, you may only distribute or sell this product if it bears this new revised labeling or subsequently approved labeling. “To distribute or sell” is defined under FIFRA section 2(gg) and its implementing regulation at 40 CFR 152.3.

If you have any questions about this letter, please contact Caleb Carr by phone at 202-566- 0636, or via email at carr.caleb@epa.gov.

S i n c e r e l y ,

Julie Javier, Team Leader Risk Mitigation and Implementation Branch 4 Pesticide Re-Evaluation Division Office of Pesticide Programs

ENCLOSURE: Stamped label

Dispersible Granules Active Ingredient By Weight Indoxacarb (S)-methyl 7-chloro-2,5-dihydro-2-[[(methoxycarbonyl)[4-(trifluoromethoxy)phenyl]amino]carbonyl]indeno [1,2-e][1,3,4]oxadiazine-4a(3H)-carboxylate 30% Other Ingredients 70% TOTAL 100% EPA Reg. No. 279-9587 EPA Est. No. ____________ Nonrefillable Container Refillable Container Net: ______________ OR Net: ______________ 1 KEEP OUT OF REACH OF CHILDREN CAUTION Si usted no entiende la etiqueta, busque a alguien para que se la explique a usted en detalle. (If you do not understand the label, find someone to explain it to you in detail.) FIRST AID IF SWALLOWED: Call a poison control center or doctor immediately for treatment advice. Have person sip a glass of water if able to swallow. Do not induce vomiting unless told to do so by the poison control center or doctor. Do not give anything by mouth to an unconscious person. IF IN EYES: Hold eye open and rinse slowly and gently with water for 15-20 minutes. Remove contact lenses, if present, after the first 5 minutes, then continue rinsing eye. Call a poison control center or doctor for treatment advice. IF ON SKIN OR CLOTHING: Remove contaminated clothing. Rinse skin immediately with plenty of water for 15-20 minutes. Call a poison control center or doctor for treatment advice. IF INHALED: Move person to fresh air. If person is not breathing, call 911 or an ambulance, then give artificial respiration, preferably by mouth-to-mouth, if possible. Call a poison control center or doctor for treatment advice. Have the product container or label with you when calling a poison control center or doctor, or going for treatment. You may also contact 1-800-331-3148for emergency medical treatment information. PRECAUTIONARY STATEMENTS HAZARDS TO HUMANS AND DOMESTIC ANIMALS Caution! Harmful if swallowed. Causes moderate eye irritation. Harmful if absorbed through skin. Avoid contact with skin, eyes or clothing. Wash thoroughly with soap and water after handling. Harmful if inhaled. Avoid breathing (dust, vapor or spray mist). Remove contaminated clothing and wash clothing before reuse. PERSONAL PROTECTIVE EQUIPMENT Some materials that are chemical resistant to this product are listed below. Applicators and other handlers must wear: /RQJVOHHYHGVKLUWORQJSDQWVVKRHVDQGVRFNV Chemical Resistant Glovessuch as butyl rubber, natural rubber, neoprene rubber or nitrile rubber, all >14 mils. AVA U N T INSECTICIDE FMC Corporation 2929 Walnut Street Philadelphia, PA 19104 Sold By ,QDGGLWLRQPL[HUVDQGORDGHUVVXSSRUWLQJDHULDODSSOLFDWLRQVWRGULHGDQGRUVXFFXOHQWEHDQVPXVWZHDUDPLQLPXPRID 1,26+DSSURYHGSDUWLFXODWHILOWHULQJIDFHSLHFHUHVSLUDWRUZLWKDQ\15RU3ILOWHU25D1,26+DSSURYHGHODVWRPHULF SDUWLFXODWHUHVSLUDWRUZLWKDQ\15RU3ILOWHU25D1,26+DSSURYHGSRZHUHGDLUSXULI\LQJUHVSLUDWRUZLWK+(ILOWHUV Nov 21, 2025 279-9587

352'8&7,1)250$7,21 AVAUNTLQVHFWLFLGH must be used only in accordance with the directions on this label or in separate FMC supplemental labelingavailable as a result of new EPA approvals. AVAUNTLQVHFWLFLGH is a water dispersible granule that can be applied as a foliar spray to control many important insects. AVAUNTLQVHFWLFLGHis mixed with water for application. 86(5(675,&7,216 • Use only in commercial and farm plantings. • Not for use in home plantings. • Do not formulate this product into any other End-use products without written permission of FMC. DIRECTIONS FOR USE It is a violation of federal law to use this product in a manner inconsistent with its labeling. Do not apply this product in a way that will contact workers or other persons, either directly or through drift. Only protected handlers may be in the area during application. For any requirements specific to your State or Tribe, consult the agency responsible for pesticide regulation. AGRICULTURAL USE REQUIREMENTS AVAUNT® LQVHFWLFLGHmust be used only in accordance with its labeling and with the Worker Protection Standard, 40 CFR part170.This Standard contains requirements for the protection of agricultural workers on farms, forests, nurseries, andgreenhouses,andhandlersofagriculturalpesticides.Itcontainsrequirementsfortraining, decontamination,notification,andemergencyassistance.Italsocontainsspecificinstructionsandexceptionspertaining tothe statementsonthislabelaboutpersonalprotectiveequipment(PPE)andrestricted-entryinterval.Therequirements inthisboxonlyapplytousesofthisproductthatarecoveredbytheWorkerProtectionStandard. Do not enter or allow worker entry into treated areas during the restricted entry interval (REI) of 12 hours for all crops. For early entry to treated areas that is permitted under the Worker Protection Standard and that involves contact with anythingthathasbeentreated,suchasplants,soil,orwater,wear: Coveralls over long-sleeved shirt and long pants, Socks plus chemical resistant footwear, Chemical Resistant Gloves Category A (such as butyl rubber, natural rubber, neoprene rubber or nitrile rubber), all > 14 mils. 2 Follow manufacturer's instructions for cleaning/maintaining personal protective equipment (PPE). If no such instructions for washables, use detergent and hot water. Keep and wash PPE separately from other laundry. When handlers use closed systems, enclosed cabs, or aircraft in a manner that meets the requirements listed in the Worker Protection Standard (WPS) for agricultural pesticides (40 CFR 170.240(d)(4-6), the handler PPE requirements may be reduced or modified as specified in the WPS. IMPORTANT: when reduced PPE is worn because a closed system is being used, handlers must be provided all PPE specified above for “applicator and other handlers” and have such PPE immediately available for use in an emergency, such as a spill or equipment breakdown. ENVIRONMENTAL HAZARDS This pesticide is toxic to mammals, birds, fish and aquatic invertebrates. Do not apply directly to water, or to areas where surface water is present or to intertidal areas below the mean high water mark. Do not contaminate water when disposing of equipment ZDVKZDWHURUULQVDWH'ULIWDQGUXQRIIPD\EHKD]DUGRXVWRDTXDWLFRUJDQLVPVLQZDWHUDGMDFHQWWRWUHDWHG DUHDV5XQRIIRIWKLVSURGXFWZLOOEHUHGXFHGE\DYRLGLQJDSSOLFDWLRQZKHQUDLQIDOOLVIRUHFDVWHGWRRFFXUZLWKLQKRXUV 5LQVLQJDSSOLFDWLRQHTXLSPHQWRYHUWKHWUHDWHGDUHDZLOOKHOSDYRLGUXQRIIWRZDWHUERGLHVRUGUDLQDJHV\VWHPV'RQRW DSSO\WRDQ\LPSHUYLRXVVXUIDFHVZKLFKPD\FRQWDFWRUOHDGGLUHFWO\WRVXUIDFHZDWHUVWRUPGUDLQVRUXUEDQUXQRII FRQYH\DQFHV\VWHPVJXWWHUVCover, incorporate, or clean up granules that are spilled.This product is highly toxic to bees exposed to direct treatment on blooming crops or weeds. Do not apply this product orallow it to drift to blooming crops or weeds while bees are foraging in the treatment area. USER SAFETY RECOMMENDATIONS USERS SHOULD: Wash hands before eating, drinking, chewing gum, using tobacco or using the toilet. Remove clothing and/or PPE immediately if pesticide gets inside. Then wash thoroughly and put on clean clothing.

3 )RUILHOGVWRZKLFKDSSOLFDWLRQVRI$9$817LQVHFWLFLGHZLOOEHPDGHFRQVWUXFWDYHJHWDWLYHILOWHUVWULSLIRQHGRHVQRW DOUHDG\H[LVW([LVWLQJDQGQHZILOWHUVWULSVPXVWEHDWDPLQLPXPIRRWZLGHDQGFRPSRVHGRIJUDVVRURWKHUSHUPDQHQW YHJHWDWLRQEHWZHHQWKHILHOGHGJHDQGGRZQJUDGLHQWDTXDWLFKDELWDWVXFKDVEXWQRWOLPLWHGWRODNHVUHVHUYRLUVULYHUV SHUPDQHQWVWUHDPVPDUVKHVRUQDWXUDOSRQGVHVWXDULHVDQGFRPPHUFLDOILVKIDUPSRQGV9HJHWDWLYHILOWHUVWULSVPXVWEH PDLQWDLQHGWRRSWLPL]HWKHLUXWLOLW\2QO\DSSO\SURGXFWVFRQWDLQLQJLQGR[DFDUERQWRILHOGVZKHUHDPDLQWDLQHGYHJHWDWLYH EXIIHUVWULSRIDWOHDVWIHHWH[LVWVEHWZHHQWKHILHOGDQGGRZQJUDGLHQWDTXDWLFKDELWDW &+(0,$7,21'RQRWDSSO\WKLVSURGXFWWKURXJKDQ\W\SHRILUULJDWLRQV\VWHPH[FHSWIRUDSSOLFDWLRQWRFUDQEHUULHVPLQW SRWDWRHVDQGVZHHWFRUQDQGDVDOORZHGE\)HGHUDO6XSSOHPHQWDODQG6SHFLDO/RFDO1HHG6/1ODEHOLQJ6HH³$SSOLFDWLRQ %\&KHPLJDWLRQ´VHFWLRQRIWKHODEHO INTEGRATED PEST MANAGEMENT )0&VXSSRUWVWKHXVHRI,QWHJUDWHG3HVW0DQDJHPHQW,30SURJUDPVWRFRQWUROSHVWV7KLVSURGXFWPD\EHXVHGDVSDUW RIDQ,30SURJUDPZKLFKFDQLQFOXGHELRORJLFDOFXOWXUDODQGJHQHWLFSUDFWLFHVDLPHGDWSUHYHQWLQJHFRQRPLFSHVW GDPDJH,30SULQFLSOHVDQGSUDFWLFHVLQFOXGHILHOGVFRXWLQJRURWKHUSHVWGHWHFWLRQPHWKRGVFRUUHFWWDUJHWSHVW LGHQWLILFDWLRQSRSXODWLRQPRQLWRULQJURWDWLRQRILQVHFWLFLGHVZLWKGLIIHUHQWPRGHVRIDFWLRQDQGWUHDWLQJZKHQWDUJHWSHVW SRSXODWLRQVUHDFKORFDOO\GHWHUPLQHGDFWLRQWKUHVKROGV&RQVXOW\RXUVWDWHFRRSHUDWLYHH[WHQVLRQVHUYLFHSURIHVVLRQDO FRQVXOWDQWVSURGXFWPDQXIDFWXUHURURWKHUTXDOLILHGDXWKRULWLHVWRGHWHUPLQHDSSURSULDWHDFWLRQWUHDWPHQWWKUHVKROGOHYHOV IRUWUHDWLQJVSHFLILFSHVWFURSRUVLWHV\VWHPVLQ\RXUDUHD SCOUTING 0RQLWRU LQVHFW SRSXODWLRQV WR GHWHUPLQH ZKHWKHU RU QRW WKHUH LV D QHHG IRU DSSOLFDWLRQ RI $9$817 LQVHFWLFLGH EDVHG RQ ORFDOO\ GHWHUPLQHG HFRQRPLF WKUHVKROGV 0RUH WKDQ RQH WUHDWPHQW RI $9$817 LQVHFWLFLGH PD\ EH UHTXLUHG WR FRQWURO D SRSXODWLRQRISHVWV INSECT RESISTANCE MANAGEMENT )RUUHVLVWDQFHPDQDJHPHQW$9$817LQVHFWLFLGHFRQWDLQVWKHDFWLYHLQJUHGLHQWLQGR[DFDUEZKLFKLVD0RGHRI$FWLRQURXS $LQVHFWLFLGH,QVHFWLFLGHVZLWKWKHVDPHJURXSQXPEHUDIIHFWWKHVDPHELRORJLFDOVLWHRIDFWLRQRQWKHWDUJHWSHVWDQGZKHQ XVHGUHSHDWHGO\LQWKHVDPHWUHDWPHQWDUHDQDWXUDOO\RFFXUULQJUHVLVWDQWLQGLYLGXDOVPD\VXUYLYHFRUUHFWO\DSSOLHGLQVHFWLFLGH WUHDWPHQWVUHSURGXFHDQGEHFRPHGRPLQDQW 7RGHOD\WKHGHYHORSPHQWRILQVHFWLFLGHUHVLVWDQFHDUHVLVWDQFHPDQDJHPHQWVWUDWHJ\VKRXOGLQFOXGHLQFRUSRUDWLRQRIFXOWXUDO DQGELRORJLFDOFRQWUROSUDFWLFHVDOWHUQDWLRQWRGLIIHUHQWPRGHRIDFWLRQLQVHFWLFLGHVRQVXFFHHGLQJJHQHUDWLRQVWDUJHWLQJWKH PRVWVXVFHSWLEOHOLIHVWDJHDQGZKHUHSRVVLEOHFRQWUROOLQJPXOWLSOHOLIHVWDJHVRIWKHVDPHSHVW &RQVXOWZLWK\RXUORFDORUVWDWHDJULFXOWXUDODXWKRULWLHVRUSURGXFWPDQXIDFWXUHURUYLVLWWKH,QVHFWLFLGH5HVLVWDQFH$FWLRQ &RPPLWWHH,5$&RQWKHZHEDWKWWSZZZLUDFRQOLQHRUJIRUPRUHLQIRUPDWLRQDERXWGHYHORSLQJDUHVLVWDQFHPDQDJHPHQW VWUDWHJ\ 8QOHVVGLUHFWHGRWKHUZLVHLQWKHVSHFLILFFURSSHVWVHFWLRQVRIWKLVODEHOIROORZWKHVHJXLGHOLQHVWRGHOD\WKHGHYHORSPHQWRI LQVHFWLFLGHUHVLVWDQFH v $SSO\$9$817LQVHFWLFLGHDQGRWKHUURXS$LQVHFWLFLGHVZLWKLQDVLQJOH³WUHDWPHQWZLGRZ´WRPLQLPL]H H[SRVLQJVXFFHVVLYHJHQHUDWLRQVRIDSHVWVSHFLHVWRWKHVDPHPRGHRIDFWLRQLQVHFWLFLGHV v $³WUHDWPHQWZLQGRZ´LVGHILQHGDVWKHSHULRGRIUHVLGXDOLQVHFWLFLGDODFWLYLW\SURYLGHGE\RQHRUPRUHDSSOLFDWLRQVRI SURGXFWVZLWKWKHVDPHPRGHRIDFWLRQQRWWRH[FHHGDSSUR[LPDWHO\GD\V v :LWKLQWKHURXS$³WUHDWPHQWZLQGRZ´PDNHQRPRUHWKDQDSSOLFDWLRQVRI$9$817LQVHFWLFLGHRURWKHUURXS $LQVHFWLFLGHV v )ROORZLQJDURXS$³WUHDWPHQWZLQGRZ´URWDWHWRD³WUHDWPHQWZLQGRZ´RIHIIHFWLYHLQVHFWLFLGHVZLWKDGLIIHUHQW PRGHRI$FWLRQURXS1XPEHU7KHSHULRGEHWZHHQURXS$³WUHDWPHQWZLQGRZV´VKRXOGEHDWOHDVWGD\V v )RUVKRUWF\FOHFURSVGD\VWKHGXUDWLRQRIWKHFURSF\FOHPD\EHFRQVLGHUHGDVWKHURXS$³WUHDWPHQW ZLQGRZ´LIQRURXS$LQVHFWLFLGHVDUHXVHGGXULQJWKHQH[WFURSF\FOHDWWKHVDPHIDUPORFDWLRQ v ,I$9$817LQVHFWLFLGHLVWDQNPL[HGZLWKRWKHULQVHFWLFLGHVWKHQDSSO\UDWHVWKDWDUHLQGLYLGXDOO\UHJLVWHUHGIRUXVH DJDLQVWWKHWDUJHWVSHFLHV'RQRWUHO\RQWKHVDPHPL[WXUHUHSHDWHGO\WRFRQWUROWKHVDPHSHVWVSHFLHVDQGIROORZWKH VDPH³WUHDWPHQWZLQGRZ´URWDWLRQUHFRPPHQGDWLRQGHVFULEHGDERYHIRUERWKWDQNPL[HGSURGXFWV v 8VHODEHOHGUDWHVRI$9$817LQVHFWLFLGHZKHQDSSOLHGDORQHRULQWDQNPL[WXUHV v 0RQLWRUDIWHUDSSOLFDWLRQIRUXQH[SHFWHGWDUJHWSHVWVXUYLYDO,ILQVHFWUHVLVWDQFHLVVXVSHFWHGFRQVXOWZLWK\RXU PDQXIDFWXUHU¶VUHSUHVHQWDWLYHORFDOXQLYHUVLW\VSHFLDOLVWRUFHUWLILHGSHVWFRQWURODGYLVRU ,IUHVLVWDQFHWR$9$817ŠGHYHORSVLQ\RXUDUHDRWKHUSURGXFWVZLWKDVLPLODUPRGHRIDFWLRQ0RGHRI$FWLRQ*URXS$ PD\QRWSURYLGHDGHTXDWHFRQWURO

 APPLICATION Apply at the listed rates when insect populations reach locally determined economic thresholds. Consult the cooperative extension service, professional consultants or other qualified authorities to determine appropriate threshold levels for treatmentin your area. Follow-up treatments of AVAUNTLQVHFWLFLGH should be applied, as needed, to keep pest populations within threshold limits. Apply AVAUNT LQVHFWLFLGH on most crops every 3 to 5 days, as specified in the specific crop sections, to maintain con Wrol. For bushberry, cranberry, dry bean, pome and stone fruit the minimum interval between treatments is 7 days. Use sufficient water to obtain thorough, uniform coverage. Because AVAUNTLQVHFWLFLGH is most effective through ingestion of treated plant material, thorough spray coverage is essential foroptimum control of targeted pest insects. Using increased water volumes will typically result in better spray coverage, especially under adverse conditions such as dry, hot weather or dense plant foliage. AVAUNTLQVHFWLFLGH may be applied by ground, aerial or overhead sprinkler chemigation application equipment. For aerial application use the following directionsunless otherwise specified in this label: use a minimum of 5 gallons per acre (gpa) of water, except in tree and vine crops use a minimum of 10 gpa. For ground applications, use the following directions unless otherwise specified in this label: use a minimum of 10 gallons per acre (gpa) of water, except in tree and vine crops use a minimum of 50 gpa and a maximum of 200 gpa of water. Use of Adjuvants: In some situations where coverage is difficult to achieve such as closed canopy, dense foliage, plants with waxy leaf surfaces, or less than optimum application equipment, an adjuvant may improve performance. Use only adjuvant products that are labeled for agricultural use and follow the directions on the manufacturer's label. For uses in fruit crops, use a proven and recommended adjuvant that does not affect fruit finish. Do not use an adjuvant on bushberries or garden beets. 635$<35(3$5$7,21 Spray equipment must be clean and free of previous pesticide deposits before applying AVAUNTLQVHFWLFLGH. Fill spray tank 1/4 to 1/2 full of water. Add AVAUNTLQVHFWLFLGHdirectly to spray tank. Mix thoroughly to fully disperse the insecticide Rncedispersed continued agitation is required. Use mechanical or hydraulic means; do not use airagitation. Spray mix must not be stored overnight in spray tank. Compatibility - Since formulations may be changed and new ones introduced, it is UHFRPPHQGHG thatusers premix a small quantity of a desired tank mix and observe for possible DGYHUVHFKDQJHV (settling out,flocculation, etc.).$YRLGPL[WXUHVRI VHYHUDOPDWHULDOVDQGYHU\FRQFHQWUDWHGVSUD\PL[WXUHV This product can be tank mixed with pesticide products labeled for use on crops on this label in accordance with the most restrictive of label limitations and precautions. Do not exceed label dosage rates. This product cannot be mixed with any product containing a label prohibition against such mixing. Tank Mixing Sequence- Add different formulation types in the sequence indicated below. Allow time for complete mixing and dispersion after addition of each product. Water soluble bags. AVAUNTLQVHFWLFLGHand other water dispersible granules. Wettable powders. Water based suspension concentrates. Water soluble concentrates. Oil based suspension concentrates. Emulsifiable concentrates. Adjuvants, surfactants, oils. Soluble fertilizers. Drift retardants. Follow local practice and manufacturer's recommendations.

Instructions for the Use of AVAUNTLQVHFWLFLGH in Overhead Sprinkler Chemigation Systems. Overhead chemigation applications offer the advantage of greater penetration and coverage of the target plant. However, typical chemigation applications are more dilute than ground or aerial applications. For best results, it is recommended to keep the concentration of AVAUNTLQVHFWLFLGH as high as possible in the application. Apply AVAUNTLQVHFWLFLGH in 0.1 to 0.2inches of water per acre. AVAUNTLQVHFWLFLGH is most active as an ingestion insecticide, although it does have activity as adirect contact insecticide. For best results, applications of AVAUNTLQVHFWLFLGH should ensure thorough coverage of the targetplant to maximize the opportunity for target insects to ingest AVAUNTLQVHFWLFLGH. Types of Chemigation Systems: AVAUNTLQVHFWLFLGH may be applied only through overhead sprinkler irrigation systems. Overhead irrigation systems includethe following; center pivot, end tow, hand move, lateral move, side roll, solid set and wheel line. Center pivot and lateralmove irrigation systems are preferred. Other overhead sprinkler systems may be used if they provide uniform water distribution. Do not apply AVAUNTLQVHFWLFLGH through any other type of irrigation system. Do not use filter screens smallerthan 50 mesh throughout the system, due to possible build up of material on 100 mesh or smaller screens. Directions for Chemigation: Preparation Use a pesticide tank for the application of AVAUNTLQVHFWLFLGH in chemigation systems. Thoroughly clean the injection systemand tank of any fertilizer or chemical residues using a standard clean-out procedure. Dispose of any residues in accordancewith State and Federal laws. With the mix tank 1/4 to 1/2 full with water and the agitator running, measure the requiredamount of AVAUNTLQVHFWLFLGH and add it to the tank. Then add additional water to bring your total pesticide mixture up to thedesired volume for your application. Note: Always add the AVAUNTLQVHFWLFLGH to water, never put AVAUNTLQVHFWLFLGH into adry tank or other mixing equipment without first adding water. See container label for tank mixing sequence. Continue toagitate the mixture throughout the application process. Use mechanical or hydraulic agitation, do not use air agitation.Highly alkaline water must be buffered so that the pH of the spray solution is in the range of neutral to slightly acidic. Injection Into Chemigation Systems Inject the proper amount of AVAUNTLQVHFWLFLGH into the irrigation water flow using a positive displacement injection pump.Inject the mixture at a point in the main irrigation water flow to ensure thorough mixing with the irrigation water. For continuously moving systems, inject the solution containing AVAUNTLQVHFWLFLGH into the irrigation water line continually anduniformly throughout the irrigation cycle. Apply in no more than 0.2 inches of water per acre. For overhead sprinkler systems that are stationary, add the solution containing AVAUNTLQVHFWLFLGH to the irrigation water line and apply no more than0.2 inches of water per acre just before the end of the irrigation cycle. Uniform Water Distribution The irrigation system used for application of AVAUNTLQVHFWLFLGH must provide for uniform distribution of AVAUNT LQVHFWLFLGH treated water. Non-uniform distribution might result in crop injury, lack of effectiveness or illegal pesticide residues in oron the crop being treated. Ensure the irrigation system is calibrated to uniformly distribute the chemigation application tothe crop. Contact the equipment manufacturer, the local University Extension agent or other experts if you have questionsabout achieving uniform distribution of the application.  SPRAY TANK CLEANOUT Prior to application , start with clean, well maintained application equipment. Immediately following application, thoroughly clean all spray equipment to reduce the risk of forming hardened deposits which might become difficult to remove. Drain spray equipment. Thoroughly rinse sprayer and flush hoses, boom and nozzles with clean water.Dr Clean all other associated application equipment. Take all necessary safety precautions when cleaning equipment. Do not clean near wells, water sources or desirable vegetation. Dispose of waste rinse water in accordance with local regulations. CROP ROTATION Crops that are on this label and alfalfa, cotton, peanuts and soybeans may be planted immediately following harvest. Do not plant for food or feed any other crops not registered for use with indoxacarb for 30 days after last use. APPLICATION BY CHEMIGATION – CRANBERRY, MINT, POTATOES, SPINACH* AND SWEET CORN *Use on spinach via overhead sprinkler irrigation is allowed only in the states of Arkansas, Georgia, Missouri, North Carolina, New Mexico, Oklahoma, and Texas unless otherwise permitted in supplemental labeling.

Equipment Calibration Calibrate the irrigation system and injector before applying AVAUNTLQVHFWLFLGH. Calibrate the injection pump while the system is running using the expected irrigation rate. If you have questions about calibration, you should contact your state extension service specialists, equipment manufacturer or other experts. Monitoring of Chemigation Applications A person knowledgeable of the chemigation system and responsible for its operation, or under the supervision of a responsible person, shall shut the system down and make necessary adjustments should the need arise. Wear the personal protective equipment as defined in the PPE section of the label for applicators and other handlers when making adjustments or repairs on the chemigation system when AVAUNTLQVHFWLFLGH is in the irrigation water. Required System Safety Devices Do not connect any irrigation system used for pesticide applications to a public water system unless the pesticide label- prescribed safety devices are in place. Public water system means a system for the provision to the public of piped water for human consumption, if such a system has at least 15 service connections or regularly serves an average of at least 25 individuals at least 60 days out of the year.

1. The system must contain a functional check valve, vacuum relief valve and low pressure drain appropriately located on the irrigation pipeline to prevent water source contamination from backflow.
2. The pesticide injection pipeline must contain a functional, automatic, quick-closing check valve to prevent the flow of fluid back toward the injection pump.
3. The pesticide injection pipeline must also contain a functional, normally closed, solenoid-operated valve located on the intake side of the injection pump and connected to the system interlock to prevent fluid from being withdrawn from the supply tank when the irrigation system is either automatically or manually shut down.
4. The system must contain functional interlocking controls to automatically shut off the pesticide injection pump when the water pump motor stops.
5. The irrigation line or water pump must include a functional pressure switch which will stop the water pump motor when the water pressure decreases to the point where pesticide distribution is adversely affected.
6. Systems must use a metering pump such as a positive displacement injection pump (e.g. diaphragm pump) effectively designed and constructed of materials that are compatible with pesticides and capable of being fitted with a system interlock.
7. Chemigation systems connected to public water systems must contain a functional, reduced-pressure zone, backflow preventer (RPZ) or the functional equivalent in the water supply line upstream from the point of pesticide introduction. As an option to the RPZ, the water from the public water system should be discharged into a reservoir tank prior to pesticide introduction. There shall be a complete physical break (air gap) between the outlet end of the fill pipe and the top or overflow rim of the reservoir tank of at least twice the inside diameter of the fill pipe. Operation Start the water pump and sprinkler, and let the system achieve the desired pressure and speed before starting the injector. Start the injector and calibrate the injection system according to the directions above. This procedure is necessary to deliver the desired rate per acre in a uniform manner. When the application is finished, allow the entire irrigation and injector system to be thoroughly flushed clean before stopping the system. • End guns must be turned off during the application, if they irrigate nontarget areas or if they do not provide uniform application and coverage. • Plug nozzles in the immediate area of control panels, chemical supply tanks and system safety devices to prevent contamination of these areas. • Do not apply when wind speed favors drift beyond the area intended for treatment. • Do not apply when system connections or fittings leak or when nozzles do not provide uniform distribution. • Do not allow irrigation water to collect or run-off during chemigation. Cleaning the System Thoroughly clean the injection system and tank of any fertilizer or chemical residues using a standard clean-out procedure. Dispose of any residues in accordance with State and Federal laws. Consult your owner’s manual or your local equipment dealer for cleanout procedures for your injection system. 

SPRAY DRIFT AERIAL APPLICATIONS x 'RQRWUHOHDVHVSUD\DWDKHLJKWJUHDWHUWKDQIHHWDERYHWKHJURXQGRUYHJHWDWLYHFDQRS\XQOHVVDJUHDWHU DSSOLFDWLRQKHLJKWLVQHFHVVDU\IRUSLORWVDIHW\ x $SSOLFDWRUVDUHUHTXLUHGWRXVHDPHGLXPRUFRDUVHUGURSOHWVL]H$6$%(6 x $SSOLFDWRUVPXVWXVHVZDWKGLVSODFHPHQWXSZLQGDWWKHGRZQZLQGHGJHRIWKHILHOG x 'RQRWDSSO\ZKHQZLQGVSHHGVH[FHHGPSKDWWKHDSSOLFDWLRQVLWH,IWKHZLQGVSHHGLVJUHDWHUWKDQPSKWKH ERRPOHQJWKPXVWEHRUOHVVIRUIL[HGZLQJDLUFUDIWDQGRUOHVVIRUKHOLFRSWHUV2WKHUZLVHWKHERRPOHQJWK PXVWEHRUOHVVIRUIL[HGZLQJDLUFUDIWDQGRUOHVVIRUKHOLFRSWHUV x 'RQRWDSSO\GXULQJWHPSHUDWXUHLQYHUVLRQV GROUND BOOM APPLICATIONS x 8VHUPXVWRQO\DSSO\ZLWKWKHUHOHDVHKHLJKWUHFRPPHQGHGE\WKHPDQXIDFWXUHUEXWQRPRUHWKDQIHHWDERYHWKH JURXQGRUFURSFDQRS\ x $SSOLFDWRUVDUHUHTXLUHGWRXVHDPHGLXPRUFRDUVHUGURSOHWVL]H$6$%(6 x 'RQRWDSSO\ZKHQZLQGVSHHGVH[FHHGPSKDWWKHDSSOLFDWLRQVLWH x 'RQRWDSSO\GXULQJWHPSHUDWXUHLQYHUVLRQV AIRBLAST APPLICATIONS x 6SUD\VPXVWEHGLUHFWHGLQWRWKHFDQRS\ x 'RQRWDSSO\ZKHQZLQGVSHHGVH[FHHGPSKDWWKHDSSOLFDWLRQVLWH x 8VHUPXVWWXUQRIIRXWZDUGSRLQWLQJQR]]OHVDWURZHQGVDQGZKHQVSUD\LQJRXWHUURZ x 'RQRWDSSO\GXULQJWHPSHUDWXUHLQYHUVLRQV SPRAY DRIFT ADVISORIES 7+($33/,&$725,65(63216,%/()25$92,',12))6,7(635$<'5,)7%($:$5(2)1($5%< 1217$5(76,7(6$1'(19,5210(17$/&21',7,216 IMPORTANCE OF DROPLET SIZE $QHIIHFWLYHZD\WRUHGXFHVSUD\GULIWLVWRDSSO\ODUJHGURSOHWV8VHWKHODUJHVWGURSOHWVWKDWSURYLGHWDUJHWSHVWFRQWURO :KLOHDSSO\LQJODUJHUGURSOHWVZLOOUHGXFHVSUD\GULIWWKHSRWHQWLDOIRUGULIWZLOOEHJUHDWHULIDSSOLFDWLRQVDUHPDGH LPSURSHUO\RUXQGHUXQIDYRUDEOHHQYLURQPHQWDOFRQGLWLRQV Controlling Droplet Size – Ground Boom x 9ROXPH±,QFUHDVLQJWKHVSUD\YROXPHVRWKDWODUJHUGURSOHWVDUHSURGXFHGZLOOUHGXFHVSUD\GULIW8VHWKHKLJKHVW SUDFWLFDOVSUD\YROXPHIRUWKHDSSOLFDWLRQ,IDJUHDWHUVSUD\YROXPHLVQHHGHGFRQVLGHUXVLQJDQR]]OHZLWKDKLJKHU IORZUDWH x 3UHVVXUH±8VHWKHORZHVWVSUD\SUHVVXUHUHFRPPHQGHGIRUWKHQR]]OHWRSURGXFHWKHWDUJHWVSUD\YROXPHDQGGURSOHW VL]H x 6SUD\1R]]OH±8VHDVSUD\QR]]OHWKDWLVGHVLJQHGIRUWKHLQWHQGHGDSSOLFDWLRQ&RQVLGHUXVLQJQR]]OHVGHVLJQHGWR UHGXFHGULIW Controlling Droplet Size – Aircraft x $GMXVW1R]]OHV±)ROORZQR]]OHPDQXIDFWXUHUUHFRPPHQGDWLRQVIRUVHWWLQJXSQR]]OHV*HQHUDOO\WRUHGXFHILQH GURSOHWVQR]]OHVVKRXOGEHRULHQWHGSDUDOOHOZLWKWKHDLUIORZLQIOLJKW BOOM HEIGHT – Ground Boom )RUJURXQGHTXLSPHQWWKHERRPVKRXOGUHPDLQOHYHOZLWKWKHFURSDQGKDYHPLQLPDOERXQFH RELEASE HEIGHT – Aircraft +LJKHUUHOHDVHKHLJKWVLQFUHDVHWKHSRWHQWLDOIRUVSUD\GULIW SHIELDED SPRAYERS 6KLHOGLQJWKHERRPRULQGLYLGXDOQR]]OHVFDQUHGXFHVSUD\GULIW&RQVLGHUXVLQJVKLHOGHGVSUD\HUV9HULI\WKDWWKHVKLHOGVDUH QRWLQWHUIHULQJZLWKWKHXQLIRUPGHSRVLWLRQRIWKHVSUD\RQWKHWDUJHWDUHD TEMPERATURE AND HUMIDITY :KHQPDNLQJDSSOLFDWLRQVLQKRWDQGGU\FRQGLWLRQVXVHODUJHUGURSOHWVWRUHGXFHHIIHFWVRIHYDSRUDWLRQ 

TEMPERATURE INVERSIONS 'ULIWSRWHQWLDOLVKLJKGXULQJDWHPSHUDWXUHLQYHUVLRQ7HPSHUDWXUHLQYHUVLRQVDUHFKDUDFWHUL]HGE\LQFUHDVLQJWHPSHUDWXUH ZLWKDOWLWXGHDQGDUHFRPPRQRQQLJKWVZLWKOLPLWHGFORXGFRYHUDQGOLJKWWRQRZLQG7KHSUHVHQFHRIDQLQYHUVLRQFDQEH LQGLFDWHGE\JURXQGIRJRUE\WKHPRYHPHQWRIVPRNHIURPDJURXQGVRXUFHRUDQDLUFUDIWVPRNHJHQHUDWRU6PRNHWKDW OD\HUVDQGPRYHVODWHUDOO\LQDFRQFHQWUDWHGFORXGXQGHUORZZLQGFRQGLWLRQVLQGLFDWHVDQLQYHUVLRQZKLOHVPRNHWKDW PRYHVXSZDUGDQGUDSLGO\GLVVLSDWHVLQGLFDWHVJRRGYHUWLFDODLUPL[LQJ$YRLGDSSOLFDWLRQVGXULQJWHPSHUDWXUHLQYHUVLRQV WIND 'ULIWSRWHQWLDOJHQHUDOO\LQFUHDVHVZLWKZLQGVSHHG$92,'$33/,&$7,216'85,1867<:,1'&21',7,216 $SSOLFDWRUVQHHGWREHIDPLOLDUZLWKORFDOZLQGSDWWHUQVDQGWHUUDLQWKDWFRXOGDIIHFWVSUD\GULIW $,566,67(',5%/$67),(/'&523635$<(56 $LUDVVLVWHGILHOGFURSVSUD\HUVFDUU\GURSOHWVWRWKHWDUJHWYLDDGRZQZDUGGLUHFWHGDLUVWUHDP6RPHPD\UHGXFHWKH SRWHQWLDOIRUGULIWEXWLIDVSUD\HULVXQVXLWDEOHIRUWKHDSSOLFDWLRQDQGRUVHWXSLPSURSHUO\KLJKGULIWSRWHQWLDOFDQUHVXOW,W LVWKHUHVSRQVLELOLW\RIWKHDSSOLFDWRUWRGHWHUPLQHWKDWDVSUD\HULVVXLWDEOHIRUWKHLQWHQGHGDSSOLFDWLRQWKDWLWLVFRQILJXUHG SURSHUO\DQGWKDWGULIWSRWHQWLDOKDVEHHQPLQLPL]HG 1RWH$LUDVVLVWHGILHOGVSUD\HUVFDQDIIHFWSURGXFWSHUIRUPDQFHE\DIIHFWLQJVSUD\FRYHUDJHDQGFDQRS\SHQHWUDWLRQ5HDG WKHVSHFLILFFURSXVHDQGDSSOLFDWLRQHTXLSPHQWLQVWUXFWLRQVWRGHWHUPLQHLIDQDLUDVVLVWHGILHOGFURSVSUD\HUFDQEHXVHG $,566,67(',5%/$6775(($1'9,1(635$<(56 $LUDVVLVWHGWUHHDQGYLQHVSUD\HUVFDUU\GURSOHWVLQWRWKHFDQRS\RIWUHHVDQGYLQHVYLDDUDGLDOO\RUODWHUDOO\GLUHFWHGDLUVWUHDP 7KHVHVSUD\HUVDUHQRWVXLWDEOHIRUDSSO\LQJKHUELFLGHV,QDGGLWLRQWRWKHJHQHUDOGULIWPDQDJHPHQWSULQFLSOHVDOUHDG\GHVFULEHG WKHIROORZLQJVSHFLILFSUDFWLFHVZLOOIXUWKHUUHGXFHWKHSRWHQWLDOIRUGULIW • $GMXVWGHIOHFWRUVDQGDLPLQJGHYLFHVVRWKDWVSUD\LVRQO\GLUHFWHGLQWRWKHFDQRS\ • %ORFNRIIXSZDUGSRLQWHGQR]]OHVZKHQWKHUHLVQRRYHUKDQJLQJFDQRS\ • 8VHRQO\HQRXJKDLUYROXPHWRSHQHWUDWHWKHFDQRS\DQGSURYLGHJRRGFRYHUDJH • 0RYHPHQWRIVSUD\WKDWJRHVEH\RQGWKHHGJHRIWKHFXOWLYDWHGDUHDPD\EHPLQLPL]HGE\SUDFWLFHVVXFKDVVSUD\LQJWKH RXWVLGHURZRQO\IURPRXWVLGHWKHSODQWLQJ 

Bean, Dried Corn Earworm 0.065 - 0.11 3.5 - 6.0 7 12 hrs (except soybean) European Corn Borer Including: Dried cultivars of  Make no more than 4 applications per acre per crop. Do not apply more than 24 ozRI AVAUNTLQVHFWLFLGH or 0.44 lbDL of inGoxacarb containing products percrop. bean(Lupinus) (includes grain lupin, Do not apply more than 72 oz  of AVAUNTLQVHFWLFLGH or 1.32 lbDL of indoxacarb containingproducts sweet lupin, white lupin, and white sweet lupin); SHUyear. The minimum interval between sprays is 7 days. Forgroundapplications,makeauniformapplication in approximately 20-100 gal$ of water. bean (Phaseolus) (includes field bean, kidney bean, lima bean (dry), navy bean, pinto bean, tepary bean); bean ( Vigna ) (includes adzuki bean, blackeyed pea, catjang, cowpea, crowder pea, moth bean, mung bean, rice bean, southern pea, urd bean); broad bean (dry); chickpea; guar; lablab bean; lentil Bean, Succulent Corn Earworm 0.065 - 0.11 3.5 - 6.0 3 12 hrs (except soybean) European Corn Borer Including: Bean (Phaseolus) includes (lima bean, green; broad bean, succulent; runner bean, 

Make no more than 4 applications per acre per crop. Donotapplymorethan14ozRIAVAUNTLQVHFWLFLGHor0.26lbDL of inGoxacarb containing products percrop. Donot apply more than 56 oz of AVAUNTLQVHFWLFLGH or 1.04 lbDL of indoxacarb containing products per\HDU Theminimum interval between sprays is 7 days. Forgroundapplications,makeauniformapplication in approximately 20-100 gal$ of water. snap bean, wax bean); bean (Vigna) (includes asparagus bean, blackeyed pea, Chinese longbean, cowpea, moth bean, southern pea, yardlong bean); jackbean; sword bean Brassica (Cole) Beet Armyworm 0.065* 3.5* 3 12 hrs. Leafy Vegetables Diamondback moth Including: Cabbage looper 0.045 - 0.065* 2.5 - 3.5* Broccoli, Cabbage webworm Chinese broccoli, (except California) Broccoli raab, Cross striped cabbageworm Brussels sprouts, (except California) Cabbage, Imported cabbageworm Chinese cabbage (napa and bok choy), Chinese mustard cabbage, Cauliflower, Cavalo broccolo, Collards, Kale, Kohlrabi, Mizuna, Mustard greens, Mustard spinach, Rape greens and Turnip tops** Make no more than 4 applications per acre per crop. Donotapplymorethan14ozRIAVAUNTLQVHFWLFLGHor0.26lbDL of indoxacarb containing products percrop. Donot apply more than 56 oz of AVAUNTLQVHFWLFLGH or 1.04 lbDL of indoxacarb containing products peryear. Theminimum interval between sprays is 3 days. Donotapplytogreenhouseorfieldgrownbrassica crops grown for transplant. ResistanceManagementforDiamondbackMoth:DonotapplyAVAUNTLQVHFWLFLGHmore than twice to anygenerationofdiamondbackmothlarvae.Afterthe secondapplication,rotatetoanother insecticidewith adifferentmodeofaction(ie.aproductwithadifferentIRACgroupnumber). Donotapplylessthan3.5R]$ofAVAUNTLQVHFWLFLGH.IfapplicationsofAVAUNTLQVHFWLFLGHdonot resultinreductionindiamondbackmothlarvaepopulations,immediatelystopuseof AVAUNTLQVHFWLFLGH andapplyaregisteredinsecticidewithadifferentmodeofaction. Donot make morethan6totalapplicationsofAVAUNTLQVHFWLFLGHpercalendaryearforcontrolof diamondbackmothperfarmlocation. IntheStateofGeorgia: Do not apply more than 4 applications of AVAUNTLQVHFWLFLGH per calendar year for the controlofdiamondbackmothperfarmlocation. *Add a wetting agent to improve spray coverage. **Foruseonturnipsgrownfortopsorgreens,not for the production of turnip roots. AVAUNTLQVHFWLFLGH Rate Per Acre Last Application Crops Insects OEDL Ounces (Days to Harvest) REI

 Bushberries Cranberry fruitworm, 0.065 - 0.11 3.5 - 6.0 7 12 hrs. Including: Cherry fruitworm Aronia berry, Winter moth Blueberries Bruce spanworm 0.11 6.0 (Highbush blueberry. Cranberry weevil (adult) and Lowbush Plum curculio (adult) blueberry), Chilean guava, Currants (Black currant, Buffalo currant, Native currant and Red currant), Make no more than 4 applications per season. Donotapplymorethan24ozofAVAUNTLQVHFWLFLGHor 0.44 lbDL of indoxacarb containing products peU year. Donot apply dilute applications of more than 200 gal$ of water. Donotuseadjuvants. Forbestresultsapplyin 20 - 50 gal of water by ground or 10 gal of water by air. Minimumintervalbetweentreatmentsis7days. European barberry, Elderberry, Gooseberry, Highbush cranberry, Honeysuckle, Huckleberry, Jostaberry, Juneberry, Salal, Sea buckthorn; cultivars, varieties and/or hybrids of these. Corn (sweet) European corn borer 0.045 - 0.065 2.5 - 3.5 3 12 hrs. For application (except California) 35 - fodder through tassle Fall armyworm & stover push only. Corn earworm 14 days for hand harvesting Make no more than 4 applications per acre per crop. Whorlstagethroughtasselpush(priortosilking)application only. Do not apply more than14oz$RI AVAUNTLQVHFWLFLGHor0.26lbDL$ofindoxacarbcontainingproductspercrop. Donotapplymorethan42oz$ofAVAUNT®or0.78lbDL$ofindoxacarbcontainingproducts per year. Theminimum interval between sprays is 3 days. OverheadChemigation-AVAUNTLQVHFWLFLGHmaybeapplied to sweet corn by overhead chemigation. For specific guidanceseelabelsectiontitledAPPLICATIONBYCHEMIGATION–CRANBERRY,MINT, POTATOES,SPINACHANDSWEETCORN.BeginapplicationwhensweetcornisintheV1(1st collar) stageofgrowthuptotasselpush(V15)whendamagefromlarvaepopulationsexceedrecommended thresholds.Forbestresults,aslurryofAVAUNTLQVHFWLFLGH,vegetableoilandanemulsifiermustbekept continuouslyagitatedintheinjectiontanktokeepthemixtureinsuspensionandtoensureapplication of the properrateperacre. Low growing berry Cranberry weevil 0.11 6.0 30 12 hrs subgroup, (except Blackheaded fireworm lowbush blueberry Black vine weevil (adult)** and strawberry) (OR and WA only) Including: Spanworm Bearberry; bilberry; cloudberry; cranberry; lingonberry; muntries; partrideberry; cultivars, varieties and/or hybrids of these Do not apply to flow through bogs or allow release of irrigation water from bogs for at least 1 day following application. Makenomorethan3applications per acre per season. Donotapplymorethan24ozofAVAUNTLQVHFWLFLGHor0.44lbDL of indoxacarb containing products perseason. Theminimum interval between sprays is 7 days. *Apply up to two applications to the spring (overwintering) generation of adult cranberry weevil prior to bloom.Donotapplymorethan12ozRIAVAUNTLQVHFWLFLGH(0.22lbai)perseasonforcontrolof cranberryweevils. **Blackvineweeviladults arenocturnal feeders - it is important to monitor adult emergence by regular sweepingortrappingintheeveninghours.Makerepeatapplicationsona7to10dayscheduleif monitoringindicatescontinuedadultfeedingactivity.Broadcastapplicationsmayneedsupplemental spot treatmentsinlocalizedareasofheavyinsectpressure.Allow5to7daystoachievemaximumresults,then follow-upwithnighttimemonitoring. AVAUNTLQVHFWLFLGH Rate Per Acre Last Application Crops Insects OEDL Ounces (Days to Harvest) REI

Cucurbit vegetables Cabbage Looper 0.045 - 0.11 2.5 - 6.0 3 12 hrs Including: Melonworm Chayote (fruit), Pickleworm Chinese waxgourd Beet Armyworm 0.065 - 0.11 3.5 - 6.0 (Chinese) preserving melon) Citron melon, Cucumber, Gherkin, Edible gourd (including hyotan, cucuzza, Make no more than 4 applications per acre per crop. Donotapplymorethan24ozRIAVAUNTLQVHFWLFLGHor0.44lbDL of indoxacarb containing products percrop. Donot apply more than 72 oz of AVAUNTLQVHFWLFLGH or 1.32 OEDL of indoxacarb containing products per year. Theminimum interval between sprays is 5 days. Forgroundapplications,applyusingaminimum of 10 gal$of water. hechima and Chinese okra), Momordica species (including balsam apple, balsam pear, bitter melon and Chinese cucumber), Muskmelon (including true canteloupe, canteloupe, casaba, crenshaw melon, golden pershaw melon, honeydew melon, honey balls, mango melon, Persian melon, pineapple melon, Santa Claus melon and snake melon), Pumpkin, Summer squash (including crookneck squash, scallop squash, straightneck squash, vegetable marrow and zucchini), Winter squash (including butter- nut squash, calabaza, hubbard squash, acorn squash and spaghetti squash) and Watermelon Fruiting Vegetables Beet armyworm 0.065 3.5 3 12 hrs. and Okra European Corn Borer* Including: eggplant, (except California) - bell groundcherry, pepper only pepino, Leafminer (Use on Florida peppers (bell, chili, tomatoes only - suppression cooking, pimento only)** and sweet), Southern armyworm tomatillo and Tomato fruitworm tomato Tomato pinworm Western yellowstriped armyworm Hornworms 0.045 - 0.065 2.5 - 3.5 Loopers Make no more than 4 applications per acre per crop. Donotapplymorethan14ozRIAVAUNTLQVHFWLFLGHor0.26OEDL of indoxacarb containing products per crop. Donot apply more than 42 oz of AVAUNTLQVHFWLFLGH or 0.78 lbDL of indoxacarb containing products per year. Theminimum interval between sprays is 5 days. *-Europeancornborerapplicationsforuseonlyon bell peppers - For best results, begin applications of AVAUNTLQVHFWLFLGHfollowingtwoapplicationsofanorgano-phosphateinsecticidelabeledforEuropean cornborer controlinbellpepper. **Suppressionofleafminer on Florida tomatoes- Use of an adjuvant may improve performance. Garden beet Beet armyworm 0.065 - 0.11 3.5 - 6.0 7 12 hrs. Make no more than 4 applications per acre per crop. Donotapplymorethan24ozRIAVAUNTLQVHFWLFLGHor0.44lbDL of indoxacarb containing products per crop. Donot apply more than 96 oz of AVAUNTLQVHFWLFLGH or 1.76 lbDL of indoxacarb containing products per year. Theminimum interval between sprays is 3 days. Donotuseadjuvants.  AVAUNTLQVHFWLFLGH Rate Per Acre Last Application Crops Insects OEDL Ounces (Days to Harvest) REI

Grape Grape leaffolder 0.065 - 0.11 3.5 - 6.0 7 12 hrs Japanese beetle (except California) Western grapeleaf skeletonizer European grapevine moth 0.09 - 0.11 5.0 - 6.0 Grape berry moth (except California) Leafhoppers (suppression only) Light brown apple moth Katydid (nymphs)* 0.11 6.0 Omnivorous leafroller Make the first application at initiation of egg hatch or at the first signs of infestation for each generation. Usethehigherapplicationrateformoderatetoheavyinsectpressure.Makeapplicationbeforepestsreach damaginglevels.Monitorfieldsandmakeanadditionalapplicationifpopulationsrebuildtopotentially damaginglevels.Applyinsufficientwatertoobtainthoroughcoverageoffoliage.Consultyourstate cooperativeextensionservice,professionalconsultantsorotherqualifiedauthoritiestodetermine appropriateactionthresholdlevelsforthesepests. Makenomorethan2applicationsperseason. Donotapplymorethan12ozRIAVAUNTLQVHFWLFLGHor0.22 lbDL of indoxacarb containing products per year. Theminimum interval between sprays is 21 days. Forbestresults,useanadjuvanttohelpincreasecoverage, penetration and thus performance.

• Forktailed bush katydid (Scudderia furcata) and Angularwinged katydid (Microcentrum retinerve). Correcttimingofsprayapplicationistotheearlynymphalstages;thoroughspraycoverageiscriticalto achievebestresults.Makerepeatapplicationsona7to10dayscheduleifmonitoringindicatescontinued feedingactivity. Small fruit vine Grape leaffolder 0.065 - 0.11 3.5 - 6.0 7 12 hrs climbing subgroup, Japanese beetle (except (except fuzzy California) kiwifruit) Western grapeleaf skeletonizer Including: Grape berry moth 0.09 - 0.11 5.0 - 6.0 Amur river grape; (except California) gooseberry; Leafhoppers (suppression kiwifruit, hardy; only) maypop; Omnivorous leafroller 0.11 6.0 schisandra berry; cultivars, varieties, and/or hybrids of these Make the first application at initiation of egg hatch or at the first signs of infestation for each generation. Usethehigherapplicationrateformoderatetoheavyinsectpressure.Makeapplicationbeforepestsreach damaginglevels.Monitorfieldsandmakeanadditionalapplicationifpopulationsrebuildtopotentially damaginglevels.Applyinsufficientwatertoobtainthoroughcoverageoffoliage.Consultyourstate cooperativeextensionservice,professionalconsultantsorotherqualifiedauthoritiestodetermine appropriateactionthresholdlevelsforthesepests. Makenomorethan2applicationsperseason. Donotapplymorethan12ozRIAVAUNTLQVHFWLFLGHor0.22 lbDL of indoxacarb containing products per year. Theminimum interval between sprays is 21 days. Forbestresults,useanadjuvanttohelpincreasecoverage, penetration and thus performance. Leafy Green Beet armyworm 0.065 - 0.11 3.5 - 6.0 3 12 hrs. Vegetables, Corn earworm (except spinach Cabbage looper 0.045 - 0.065 2.5 - 3.5 and spinach varieties) Including: Arugula (Roquette), Chervil, Edible-leaved Make no more than 4 applications per season. Donotapplymorethan24oz RIAVAUNT LQVHFWLFLGHor0.44 lb  DL of indoxacarb containing products percrop. Donot apply more than 96 oz  of AVAUNT  LQVHFWLFLGH or 1.76 lb  DL of indoxacarb containing products peryear. Theminimum interval between sprays is 3 days. chrysanthemum, Garland chrysanthe- mum, Corn salad, Garden cress, Upland cress (yellow rocket, winter cress), Dandelion, Dock (sorrel), Endive (escarole), Head and Leaf Lettuce, Orach, Parsley, Garden Purslane, Winter purslane and Radicchio (red chicory) Leafy petioles Beet Armyworm 0.065 3.5 3 12 hrs Including: Cabbage looper Cardoon, Celery, Chinese celery, Celtuce, Florence fennel (finochio), Rhubarb and Swiss chard Make no more than 4 applications per season. Donotapplymorethan14ozRIAVAUNTLQVHFWLFLGHor0.26 lbDL of indoxacarb containing products percrop. Donot apply more than 56 oz of AVAUNTLQVHFWLFLGH or 1.04 lbDL of indoxacarb containing products peryear. Theminimum interval between sprays is 3 days.  AVAUNTLQVHFWLFLGH Rate Per Acre Last Application Crops Insects OEDL Ounces (Days to Harvest) REI

Mint Cabbage looper 0.065 3.5 7 12 hrs (Peppermint and Spotted cutworm Spearmint) Make no more than 4 applications per acre per crop. Donotapplymorethan14ozRIAVAUNTLQVHFWLFLGHor0.26lbDL of indoxacarb containing products per year Theminimum interval between sprays is 3 days. Forgroundapplications,applyusingaminimum of 20 gal$ofwater. AVAUNTLQVHFWLFLGH may be applied to mint by overhead chemigation. For specific guidance see label section titled APPLICATIONBYCHEMIGATION–CRANBERRY,MINT,POTATOES,SPINACH ANDSWEET CORN. Pear Codling moth - East of the 0.09 - 0.11 5.0 - 6.0 28 12 hrs. Rocky Mountains Codling moth - West of the 0.09 - 0.11 5.0 - 6.0 Rocky Mountains Light brown apple moth 0.09 - 0.11 5.0 - 6.0 Oriental fruit moth Pandemis leafroller (except California) Redbanded leafroller White apple leafhopper (except California) Make no more than 3 applications prior to hand-thinning. No hand-thinning after the 4th application.Make nomorethan4applicationsperseason.Donotapplymorethan24oz$of AVAUNTLQVHFWLFLGH or 0.44lb DL$ofindoxacarbcontainingproductsperyear.Donotapplydiluteapplicationsofmore than200gal$RI water.Forbestresultsapply50-150gal$RIwater.Theminimuminterval betweentreatmentsis7days. West of the Rockies. For use against low to moderate infestations in conjunction with alternate control measuressuchasestablishedMatingDisruptionblocks. Pome Fruit (except Codling moth - East of the 0.09 - 0.11 5.0 - 6.0 14 12 hrs. pear) Rocky Mountains Including: Codling moth - West of the 0.09 - 0.11 5.0 - 6.0 Apple, Crabapple, Rocky Mountains Loquat, Mayhaw, European apple sawfly 0.09 - 0.11 5.0 - 6.0 and Quince (except California) Green fruitworm (except California) Lesser appleworm Light brown apple moth Oriental fruit moth Pandemis leafroller Plum curculio Potato leafhopper Redbanded leafroller Spotted tentiform leafminer

• suppression only** (except California) Tarnished plant bug Tufted apple bud moth White apple leafhopper*** Lacanobia fruitworm 0.056 - 0.11 3.0 - 6.0 (except California) Apple maggot**** 0.11 6.0 Make no more than 3 applications prior to hand-thinning. No hand-thinning after the 4thapplication.Make nomore than 4 applications per season. Do not apply more than 24 oz$ of AVAUNTLQVHFWLFLGH or 0.44 lb DL$ ofindoxacarbcontainingproductsperyear.Donotapplydiluteapplicationsofmorethan200gal$RI water.Forbestresultsapply50-150gal$RIwater.Theminimumintervalbetween treatmentsis7days. *West of the Rockies. For use against low to moderate infestations in conjunction with alternate control measuressuchasestablishedMatingDisruptionblocks. **Useofanadjuvantmayimproveperformance. Forbestresults,especiallywhenusingtheloweruse rate, use an adjuvant. ***Whiteappleleafhopper(ORandWAonly)-applicationratesof2.5-4.9 R](0.045-0.089lbDL) maybeusedforsuppressionoflightinfestations. ****Applemaggot-applemaggotenteringtheorchardfromborderareasmay not be controlled iftheydonotfeedontreatedapplespriortooviposition.  AVAUNTLQVHFWLFLGH Rate Per Acre Last Application Crops Insects OEDL Ounces (Days to Harvest) REI

Spinach, New Beet armyworm 0.065 3.5 3 12 hrs Zealand spinach, Cabbage looper Vine spinach and Amaranth (leafy amaranth, Chinese spinach amaranth) Make no more than 4 applications per acre per crop. Donotapplymorethan14ozRIAVAUNTLQVHFWLFLGHor0.26lbDL of indoxacarb containing products percrop. Donot apply more than 56 oz of AVAUNTLQVHFWLFLGH or 1.04 lbDL of indoxacarb containing products peryear. Theminimum interval between sprays is 3 days. Makesequentialapplicationsat3dayintervalsor until insect populations are brought below threshold.Use onspinachviaoverheadsprinklerirrigationisallowedonlyinthestatesofArkansas,Georgia, Missouri, NorthCarolina,NewMexico,Oklahoma,andTexasunlessotherwisepermittedinsupplementallabeling. ForspecificguidanceseelabelsectiontitledAPPLICATIONBYCHEMIGATION– CRANBERRY, MINT,POTATOES,SPINACHANDSWEETCORN. Stone Fruit Light brown apple moth 0.09 - 0.11 5.0 - 6.0 14 Including: Apricot, Plum curculio 12 hrs. Sweet cherry, Tart Katydid (nymphs) 0.11 6.0 cherry, Nectarine, Oriental fruit moth** Peach, Plum, Peach twig borer*** Chicksaw plum, Damson plum, Japanese plum, Plumcot and Prune Make no more than 3 applications prior to hand-thinning. No hand-thinning after the 4th application. Makenomorethan4applicationsperseason.Donotapplymorethan24oz$ofAVAUNTLQVHFWLFLGHor 0.44lbDL$ofindoxacarbcontainingproductsperyear.Donotapplydiluteapplicationsofmorethan200 gal$RIwater.Forbestresultsapply50-150gal$RIwater.Theminimum intervalbetweentreatmentsis7 days.

• Forktailed bush katydid (Scudderia furcata) and Angularwinged katydid (Microcentrum retinerve)-Correct timingofsprayapplicationistotheearlynymphalstages;thoroughspraycoverageiscriticaltoachievebest results.Makerepeatapplicationsona710dayscheduleifmonitoringindicatescontinued feedingactivity. Orientalfruitmoth (OFM) - For applications East of the Rockies: AVAUNTLQVHFWLFLGHis effective for control ofOFMwhenusedaspartofaneffectiveIPMprogram.Rotatetoaproductwithanothermodeof actionaftereachAVAUNTLQVHFWLFLGHapplication.WestoftheRockies:AVAUNTLQVHFWLFLGHprovides suppressiononlyofOFM.*Peachtwigborer-AVAUNTLQVHFWLFLGHmaybeusedasanearlybloomor in-seasonsprayforpeachtwig borer.AVAUNTLQVHFWLFLGHprovidescontroloffruitstrikesbypeachtwig borerandsuppressionofshootstrikes.

Peachtwigborer(dormantanddelayeddormant,CAonly)-A9$817LQVHFWLFLGHmaybeusedasa dormantordelayed-dormant spray for the control of first generation peach twig borer. Make application with an EPA registered dormant oil; for specific recommendations on the use of oil consult the manufacturer's label. For best performance,groundapplicationequipmentisrecommended. Tuberous and Corm Cabbage looper 0.045 - 0.11 2.5 - 6.0 7 12 hrs. Vegetables Colorado potato beetle* 0.065 - 0.11 3.5 - 6.0 Including: European corn borer Arracacha, (except California) Arrowroot, Potato tuberworm** 0.056 - 0.11 3.0 - 6.0 Chinese Artichoke, Jerusalem Artichoke, Edible Canna (Queensland arrowroot), Bitter and Sweet Cassava, Chayote (root), Chufa, Dasheen (taro), Ginger, Leren, Potato, Potato, Tanier (cocoyam), Tumeric, Yam Bean (jicama, manoic pea), and True Yam Make no more than 4 applications per acre per crop. Donotapplymorethan24ozofAVAUNTLQVHFWLFLGHor0.44 lbDL of indoxacarb containing products per crop. Donot apply more than 96 oz of AVAUNTLQVHFWLFLGH or 1.76 lbDL of indoxacarb containing products peryear. Theminimum interval between sprays is 5 days. ForPOTATOonly-AVAUNTLQVHFWLFLGHmaybeapplied by overhead chemigation. For specific guidance see label sectiontitledAPPLICATIONBYCHEMIGATION–CRANBERRY,MINT,POTATOES, SPINACH*ANDSWEETCORN. *Colorado potato beetle - In situations where Colorado potato beetle populations are known orSweet suspectedtobedifficulttocontrol withcurrentinsectcontrolproducts,theinclusionofpiperonylbutoxide (PBO),asynergist,withAVAUNTLQVHFWLFLGHmaybenecessarytoachieveoptimumcontrol.Inthese situations,acombinationofAVAUNTLQVHFWLFLGHappliedatarateof3.5-6.0oz$combinedwith0.25lb DL$ofPBOmaybenecessarytoachievethemosteffective controlofColoradopotatobeetlelarvae.Apply thelowratesonsmallplants,small insects and light infestations of insects. Useintermediateratesonlarge insectsandheavierinfestationsofinsects.Usethehighestspecifiedrateforcontrollingsevereinfestations. ApplyAVAUNTLQVHFWLFLGHinsecticideasathoroughcoveragesprayusingproperlycalibratedairorground sprayequipment.Usesufficientwatertoobtainthoroughanduniformcoverage.Foraerialapplication,usea minimumof5gal$ofwater. **Potatotuberwormfoliarfeeding larvae - AVAUNTLQVHFWLFLGHis most effective when applied by ground, air oroverheadchemigationtovigorouslygrowingplantsthroughtuberbulkingpriortothebeginningofcrop scenescence.Forcontrolofpotatotuberwormfoliarfeedinglarvae,applyAVAUNTLQVHFWLFLGHinsecticide whentuberwormlarvaeand/ormothcountsreachlocallyestablishedtreatmentthresholdpopulations. AVAUNTLQVHFWLFLGHisabsorbedintoleaftissueviatranslaminarmovementandismosteffectivewhen appliedtovigorouslygrowingplantsthroughtuberbulking(GrowthStageIV)priortothebeginningofcrop scenescence(GrowthStageV).Repeatapplicationsofeffectiveinsecticidesmaybeneededtokeep tuberwormlarvaepopulationsaslowaspossiblepriortoharvestinordertoreducetheriskoftuberdamage. Failure to adequatelycontroltuberwormlarvaepriortocropscenescenceorvinekillincreasestheriskof tuberdamage.Toimprovecontrolofadults(moths),applyAVAUNTLQVHFWLFLGHinatankmixwitha pyrethroidinsecticide,suchas“AsanaŠ”XL. Potatotuberwormisa difficult pest to control due to several factors; eggs can be laid deep in the canopyand ontheundersideoftheleaf,andlarvaefeedinsidetheleavespriortomovingtothesoiltofeedonthetubers. Anintegratedsprayapproachisessential.Foliarspraysalone(groundorair)maynotprovideadequate controloflarvaeinthemidtolowercropcanopy.Forbestresults,applyviachemigationorintegrate chemigationapplicationsintothefoliarsprayprogram.Ensurethoroughcoveragebyusingsufficientspray volumes.Forgroundapplicationsuseatleast10gallonsofwaterperacre.Foraerialapplications,useatleast 5gal$ofwater.Forbestresultswithfoliarsprays,addMethylated SeedOil (MSO)asasprayadjuvantat1galper100galofsprayvolume(1%v/v).Forchemigation applications, applyin0.1to0.2acreinchofwaterandaddMSOat12to16floz/A. DonotmakemorethantwosequentialapplicationsofAVAUNTLQVHFWLFLGHforcontrolofpotato tuberworm beforerotatingtoanotherregisteredinsecticidehavingadifferentmodeofaction.  AVAUNTLQVHFWLFLGH Rate Per Acre Last Application Crops Insects OEDL Ounces (Days to Harvest) REI

 NOTICE TO BUYER--Purchase of this material does not confer any rights under patents of countries outside of the United States. FMC and AVAUNT are trademarks or registered trademarks of FMC Corporation or an affiliate. “Asana” is a registered trademark of Sumitomo Chemical Company, Limited. “Asana” XL LVD restricted use pesticide. '  STORAGE AND DISPOSAL Do not contaminate water, food, or feed by storage or disposal. PESTICIDESTORAGE:Donotsubjecttotemperaturesbelow32degreesF.Storeproductinoriginalcontainer only in a location inaccessible to children and pets. Do not contaminate water, other pesticides, fertilizer, food or feed instorage.Notforuseorstorageinoraroundthehome. PESTICIDEDISPOSAL:Donotcontaminatewater,foodorfeedbystorageordisposal. Wastes resulting from the use of this product must be disposed of on site or at an approved waste disposal facility. CONTAINER HANDLING:Refer to the Net Contents section of this product's labeling for the applicable "RefillableContainer"or"NonrefillableContainer"designation. ForSmall(Capacity equaltoorlessthan50Pounds)DisposableContainers:Nonrefillablecontainer.Donot reuse or refill this container. Triple rinse container (or equivalent) promptly after emptying. Triple rinse as follows: Emptytheremainingcontentsintoapplicationequipmentoramixtank.Fillthecontainer1/4fullwithwaterand recap.Shakefor10seconds.Pourrinsateintoapplicationequipmentoramixtankorstorerinsateforlateruse or disposal.Drainfor10secondsaftertheflowbeginstodrip.Repeatthisproceduretwomoretimes.Thenofferfor recyclingifavailableorpunctureanddisposeofinasanitarylandfill,orbyincineration,or,ifallowedbystateand localauthorities,byburning;ifburned,stayoutofsmoke. ForLarge(Capacitygreaterthan50Pounds)DisposableContainers:Nonrefillablecontainer.Donotreuseor refill this container. Triple rinse container (or equivalent) promptly after emptying. Triple rinse as follows: Empty the remainingcontentsintoapplicationequipmentoramixtank.Fillthecontainer1/4fullwithwater.Replaceand tightenclosures.Tipcontaineronitssideandrollitbackandforth,ensuringatleastonecompleterevolution, for 30 seconds.Standthecontaineronitsendandtipitbackandforthseveraltimes.Emptytherinsateintoapplication equipmentoramixtankorstorerinsateforlateruseordisposal.Repeatthisproceduretwomoretimes.Thenoffer for recyclingifavailableorpunctureanddisposeofinasanitarylandfill,orbyincineration,or,ifallowedbystateand localauthorities,byburning;ifburned,stayoutofsmoke. ForNonrefillablePaperorPlasticBagsorFiberSacks:Nonrefillablecontainer.Donotreuseorrefillthis container. Completely empty paper or plastic bag or fiber sack into manufacturing or application equipment by shakingandtappingsidesandbottomtoloosenclingingparticles.Emptyresidueintoapplication equipment.Then offerforrecycling,ifavailableordisposeofemptypaperorplasticbagorfibersackinasanitarylandfill,orby incineration,or,ifallowedbystateandlocalauthorities,byburning.Ifburned,stayoutofsmoke. ForNonrefillableFiberDrumsWithLiners:Nonrefillablecontainer.Donotreuseorrefillthiscontainer. Completely empty liner by shaking and tapping sides and bottom to loosen clinging particles. Empty residue into applicationequipment.Thenofferthelinerforrecyclingifavailableordisposeoflinerinasanitarylandfill,orby incineration,or,ifallowedbystateandlocalauthorities,byburning.Ifburned,stayoutofsmoke.Ifdrumis contaminatedandcannotbereused,disposeofit inthemannerrequiredforitsliner. ForRefillableFiberDrumsWithLiners:Refillablecontainer(fiberdrumonly).RefillthiscontainerwithAVAUNT insectLFLGH containing indoxacarb only. Do not reuse this container for any other purpose. Completelyemptylinerby shakingandtappingsidesandbottomtoloosenclingingparticles.Emptyresidueintoapplicationequipment.Then offerthelinerforrecyclingifavailableordisposeoflinerinasanitarylandfill,orbyincineration,or,ifallowedby stateandlocalauthorities,byburning.Ifburned,stayoutofsmoke.Cleaningthecontainer(fiberdrum)beforefinal disposalistheresponsibilityofthepersondisposingofthecontainer.Cleaningbeforerefillingistheresponsibilityof therefiller.Tocleanthecontainer(fiberdrum)beforefinaldisposal,completelyemptycontainerbyshakingand tappingsidesandbottomtoloosenclingingparticles.Emptyresidueintoapplicationequipment.Thenofferthe containerforrecyclingifavailableordisposeoflinerinasanitarylandfill,orbyincineration,or,ifallowedbystate andlocalauthorities,byburning.Ifburned,stayoutofsmoke. ForAllOtherRefillableContainers:Refillablecontainer.RefillthiscontainerwithAVAUNTinsectLFLGH containing indoxacarb only. Do not reuse this container for any other purpose. Cleaning the container before final disposalistheresponsibilityofthepersondisposingofthecontainer.Cleaningbeforerefillingistheresponsibility of therefiller.Tocleanthecontainerbeforefinaldisposal,empty theremainingcontentsfromthiscontainerinto applicationequipmentormixtank.Fillthecontainerabout10percentfullwithwater.Agitatevigorouslyorrecirculate waterwiththepumpfor2minutes.Pourorpumprinsateintoapplicationequipmentorrinsatecollectionsystem. Repeatthisrinsingproceduretwomoretimes. Do not transport if container is damaged or leaking. If the container is damaged, leaking or obsolete, or in the event of a majorspill,fireorotheremergency,contactCHEMTREC(TransportationandSpills)at1-800-424-9300,dayornight.

 FMC Corporation, 2929 Walnut Street, Philadelphia, PA 19104 © 2000-201 FMC Corporation. All rights reserved. CONDITIONS OF SALE AND LIMITATION OF WARRANTY AND LIABILITY Notice: Read the entire Directions for Use and Conditions of Sale and Limitation of Warranty and Liability before buying or using this product. If the terms are not acceptable, return the product at once, unopened, and the purchase price will be refunded. The Directions for Use of this product must be followed carefully. It is impossible to eliminate all risks inherently associated with the use of this product. Crop injury, ineffectiveness, or other unintended consequences may result because of such factors as manner of use or application, weather or crop conditions beyond the control of FMC or Seller. To the extent consistent with applicable law, all such risks shall be assumed by Buyer and User, and, to the extent consistent with applicable law, Buyer and User agree to hold FMC and Seller harmless for any claims relating to such factors. Seller warrants that this product conforms to the chemical description on the label and is reasonably fit for the purposes stated on the Directions for Use when used in accordance with the directions under normal conditions of use. TO THE EXTENT CONSISTENT WITH APPLICABLE LAW, FMC MAKES NO WARRANTIES OF MERCHANTABILITY OR OF FITNESS FOR A PARTICULAR PURPOSE, NOR ANY OTHER EXPRESS OR IMPLIED WARRANTIES WITH RESPECT TO THE SELECTION, PURCHASE, OR USE OF THIS PRODUCT. Any warranties, express or implied, having been made are inapplicable if this product has been used contrary to label instructions, or under abnormal conditions, or under conditions not reasonably foreseeable to (or beyond the control of) Seller or FMC, and, to the extent permitted by applicable law, Buyer assumes the risk of any such use. To the extent consistent with applicable law, FMC or Seller shall not be liable for any incidental, consequential or special damages resulting from the use or handling of this product. TO THE EXTENT CONSISTENT WITH APPLICABLE LAW, THE EXCLUSIVE REMEDY OF THE USER OR BUYER, AND THE EXCLUSIVE LIABILITY OF FMC AND SELLER FOR ANY AND ALL CLAIMS, LOSSES, INJURIES OR DAMAGES (INCLUDING CLAIMS BASED ON BREACH OF WARRANTY, CONTRACT, NEGLIGENCE, TORT, STRICT LIABILITY OR OTHERWISE) RESULTING FROM THE USE OR HANDLING OF THIS PRODUCT, SHALL BE THE RETURN OF THE PURCHASE PRICE OF THE PRODUCT OR, AT THE ELECTION OF FMC OR SELLER, THE REPLACEMENT OF THE PRODUCT. This Condition of Sale and Limitation of Warranty and Liability may not be amended by any oral or written agreement.