Files
crop-chem-docs/corpus/epa_ppls/5905-638.md
T
justinandClaude Opus 4.7 a97107de46
Image rebuild (skip scrape) / build (push) Failing after 1h37m12s
docker: production image + Gitea Actions for monthly refresh
Dockerfile: self-contained image with corpus + Chroma + BM25 baked
in. Drawbar's compose pulls + runs without volume mounts. Built from
sources.json (labels schema), PRODUCT_NAME=crop_chem by default,
HYBRID_SEARCH=true (always-on for production quality). RERANK_URL +
OLLAMA_URL get set at compose time.

.gitea/workflows/refresh.yml: monthly cron (1st @ 06:00 UTC) does
full scrape → reindex → image push. Scrapes Bayer (~30 min) +
EPA PPLS row-crop filtered (~7h). Skips reindex+push if no corpus
diff. Tags pushed: :latest, :<sha12>, :corpus-<YYYY.MM.DD>.

.gitea/workflows/image-only.yml: on-demand or auto on code-only
pushes to main (paths: docs_mcp/, rag/, scrape/, requirements.txt,
Dockerfile, sources.json). Reindexes from committed corpus, builds
image, pushes. ~10 min vs ~9h full refresh.

.gitignore: corpus/ now COMMITTED (4,159 labels, 265 MB of .md +
sidecars). Lets image-only.yml rebuild indexes without re-scraping.
chroma/ + bm25/ still gitignored (regenerable binary indexes).

.dockerignore: drops venv, eval results, PLAN/README/CLAUDE.md,
deploy/, .git/ — keeps the image lean. corpus + chroma + bm25
explicitly NOT in dockerignore (those go INTO the image).

Co-Authored-By: Claude Opus 4.7 (1M context) <[email protected]>
2026-05-24 12:32:41 -04:00

107 KiB
Raw History

DICAMBA 48.2%


5HJLVWUDWLRQ1RWLFH&RQGLWLRQDOY      86(19,5210(17$/3527(&7,21$*(1&< 2IILFHRI3HVWLFLGH3URJUDPV 5HJLVWUDWLRQ'LYLVLRQ 3  3HQQV\OYDQLD$YH1: :DVKLQJWRQ'&  (3$5HJ1XPEHU    'DWHRI,VVXDQFH   127,&(2)3(67,&,'( ;5HJLVWUDWLRQ 5HUHJLVWUDWLRQ  7HUPRI,VVXDQFH &RQGLWLRQDO  XQGHU),)5$DVDPHQGHG   1DPHRI3HVWLFLGH3URGXFW ',&$0%$  1DPHDQG$GGUHVVRI5HJLVWUDQW LQFOXGH=,3&RGH  *OHQGD+DDJH &KDPSLRQ&URS&DUH  UG$YH6: /H0DUV,RZD  1RWH&KDQJHVLQODEHOLQJGLIIHULQJLQVXEVWDQFHIURPWKDWDFFHSWHGLQFRQQHFWLRQZLWKWKLVUHJLVWUDWLRQPXVWEHVXEPLWWHGWRDQGDFFHSWHGE\WKH 5HJLVWUDWLRQ'LYLVLRQSULRUWRXVHRIWKHODEHOLQFRPPHUFH,QDQ\FRUUHVSRQGHQFHRQWKLVSURGXFWDOZD\VUHIHUWRWKHDERYH(3$UHJLVWUDWLRQQXPEHU  2QWKHEDVLVRILQIRUPDWLRQIXUQLVKHGE\WKHUHJLVWUDQWWKHDERYHQDPHGSHVWLFLGHLVKHUHE\UHJLVWHUHG XQGHUWKH)HGHUDO,QVHFWLFLGH)XQJLFLGHDQG5RGHQWLFLGH$FW  5HJLVWUDWLRQLVLQQRZD\WREHFRQVWUXHGDVDQHQGRUVHPHQWRUUHFRPPHQGDWLRQRIWKLVSURGXFWE\WKH $JHQF\,QRUGHUWRSURWHFWKHDOWKDQGWKHHQYLURQPHQWWKH$GPLQLVWUDWRURQKLVPRWLRQPD\DWDQ\ WLPHVXVSHQGRUFDQFHOWKHUHJLVWUDWLRQRIDSHVWLFLGHLQDFFRUGDQFHZLWKWKH$FW7KHDFFHSWDQFHRIDQ\ QDPHLQFRQQHFWLRQZLWKWKHUHJLVWUDWLRQRIDSURGXFWXQGHUWKLV$FWLVQRWWREHFRQVWUXHGDVJLYLQJWKH UHJLVWUDQWDULJKWWRH[FOXVLYHXVHRIWKHQDPHRUWRLWVXVHLILWKDVEHHQFRYHUHGE\RWKHUV   7KLVSURGXFWLVFRQGLWLRQDOO\UHJLVWHUHGLQDFFRUGDQFHZLWK),)5$VHFWLRQ F  $ <RXPXVWFRPSO\ ZLWKWKHIROORZLQJFRQGLWLRQV  6XEPLWDQGRUFLWHDOOGDWDUHTXLUHGIRUUHJLVWUDWLRQUHUHJLVWUDWLRQUHJLVWUDWLRQUHYLHZRI\RXU SURGXFWXQGHU),)5$ZKHQWKH$JHQF\UHTXLUHVDOOUHJLVWUDQWVRIVLPLODUSURGXFWVWRVXEPLWVXFK GDWD   6LJQDWXUHRI$SSURYLQJ2IILFLDO  *UDQW5RZODQG$FWLQJ3URGXFW0DQDJHU +HUELFLGH%UDQFK5HJLVWUDWLRQ'LYLVLRQ 3   'DWH   (3$)RUP  6LQFHUHO\

3DJHRI (3$5HJ1R 'HFLVLRQ1R  <RXDUHUHTXLUHGWRFRPSO\ZLWKWKHGDWDUHTXLUHPHQWVGHVFULEHGLQWKH'&,LGHQWLILHGEHORZ D 'LFDPED*'&, <RXPXVWFRPSO\ZLWKDOORIWKHGDWDUHTXLUHPHQWVZLWKLQWKHHVWDEOLVKHGGHDGOLQHV,I\RXKDYH TXHVWLRQVDERXWWKHOLVWHGDERYH\RXPD\FRQWDFWWKH&KHPLFDO5HYLHZ0DQDJHULQWKH3HVWLFLGH 5HHYDOXDWLRQ'LYLVLRQKWWSLDVSXEHSDJRYDSH[SHVWLFLGHVI"S FKHPLFDOVHDUFK   0DNHWKHIROORZLQJODEHOFKDQJHVEHIRUH\RXUHOHDVHWKHSURGXFWIRUVKLSPHQW x 5HYLVHWKH(3$5HJLVWUDWLRQ1XPEHUWRUHDG³(3$5HJ1R´  6XEPLWRQHFRS\RIWKHILQDOSULQWHGODEHOIRUWKHUHFRUGEHIRUH\RXUHOHDVHWKHSURGXFWIRU VKLSPHQW 6KRXOG\RXZLVKWRDGGUHWDLQDUHIHUHQFHWRWKHFRPSDQ\¶VZHEVLWHRQ\RXUODEHOWKHQSOHDVHEHDZDUH WKDWWKHZHEVLWHEHFRPHVODEHOLQJXQGHUWKH)HGHUDO,QVHFWLFLGH)XQJLFLGHDQG5RGHQWLFLGH$FWDQGLV VXEMHFWWRUHYLHZE\WKH$JHQF\,IWKHZHEVLWHLVIDOVHRUPLVOHDGLQJWKHSURGXFWZRXOGEHPLVEUDQGHG DQGXQODZIXOWRVHOORUGLVWULEXWHXQGHU),)5$VHFWLRQ D  ( &)5 D  OLVWH[DPSOHV RIVWDWHPHQWV(3$PD\FRQVLGHUIDOVHRUPLVOHDGLQJ,QDGGLWLRQUHJDUGOHVVRIZKHWKHUDZHEVLWHLV UHIHUHQFHGRQ\RXUSURGXFW¶VODEHOFODLPVPDGHRQWKHZHEVLWHPD\QRWVXEVWDQWLDOO\GLIIHUIURPWKRVH FODLPVDSSURYHGWKURXJKWKHUHJLVWUDWLRQSURFHVV7KHUHIRUHVKRXOGWKH$JHQF\ILQGRULILWLVEURXJKWWR RXUDWWHQWLRQWKDWDZHEVLWHFRQWDLQVIDOVHRUPLVOHDGLQJVWDWHPHQWVRUFODLPVVXEVWDQWLDOO\GLIIHULQJIURP WKH(3$DSSURYHGUHJLVWUDWLRQWKHZHEVLWHZLOOEHUHIHUUHGWRWKH(3$¶V2IILFHRI(QIRUFHPHQWDQG &RPSOLDQFH ,I\RXIDLOWRVDWLVI\WKHVHGDWDUHTXLUHPHQWV(3$ZLOOFRQVLGHUDSSURSULDWHUHJXODWRU\DFWLRQLQFOXGLQJ DPRQJRWKHUWKLQJVFDQFHOODWLRQXQGHU),)5$VHFWLRQ H <RXUUHOHDVHIRUVKLSPHQWRIWKHSURGXFW FRQVWLWXWHVDFFHSWDQFHRIWKHVHFRQGLWLRQV$VWDPSHGFRS\RIWKHODEHOLVHQFORVHGIRU\RXUUHFRUGV 3OHDVHDOVRQRWHWKDWWKHUHFRUGIRUWKLVSURGXFWFXUUHQWO\FRQWDLQVWKHIROORZLQJ&6)V  %DVLF&6)GDWHG11/07/2017 ,I\RXKDYHDQ\TXHVWLRQVSOHDVHFRQWDFW*UDQW5RZODQGE\SKRQHDWRUYLDHPDLODW URZODQGJUDQW#HSDJRY (QFORVXUH

1 DICAMBA 48.2%

For Weed Control in Corn, Sorghum, Small Grains, Pasture, Hay, Rangeland, General Farmstead (Non- Cropland), Fallow, Cotton, Sugarcane, Asparagus, Turf, and Grass Seed Crops Group 4 Herbicide ACTIVE INGREDIENT: Dimethylamine salt of dicamba (3,6-dichloro-o-anisic acid)* ............................... 48.2% OTHER INGREDIENTS: ............................................................................................ 51.8% TOTAL............................................................................................................ 100.0% *This product contains 40% 3,6-dichloro-o-anisic acid (dicamba) or 4 pounds per gallon (480 g/L) KEEP OUT OF REACH OF CHILDREN WARNING – AVISO Si usted no entiende la etiqueta, busque a alguien para que se la explique a usted en detalle. (If you do not understand the label, find someone to explain it to you in detail.) FIRST AID If in eyes: x Hold eye open and rinse slowly and gently with water for 15-20 minutes. x Remove contact lenses, if present, after the first 5 minutes, then continue rinsing eye. x Call a poison control center or doctor for treatment advice. If swallowed: x Call a poison control center or doctor immediately for treatment advice. x Have person sip a glass of water if able to swallow. x Do not induce vomiting unless told to do so by the poison control center or doctor. x Do not give anything by mouth to an unconscious person. HOT LINE NUMBER Have the product container or label with you when calling a poison control center or doctor, or going for treatment. You may also contact 1-800-222-1222 for emergency medical treatment information. NOTE TO PHYSICIAN Probable mucosal damage may contraindicate the use of gastric lavage. {See inside label booklet for DIRECTIONS FOR USE and additional PRECAUTIONARY STATEMENTS} EPA Reg. No. 91543- EPA Est. No. Net Contents Manufactured for: Champion Crop Care P.O. Box 1501 Madison, MS 39130 04/30/2018 91543-6

2 PRECAUTIONARY STATEMENTS HAZARDS TO HUMANS AND DOMESTIC ANIMALS WARNING Causes substantial but temporary eye injury. Harmful if swallowed. Do not get in eyes or on clothing. Avoid contact with skin.

PERSONAL PROTECTIVE EQUIPMENT (PPE) Some materials that are chemical-resistant to this product are butyl rubber, natural rubber, neoprene rubber or nitrile rubber. If you want more options, follow the instructions for Category A on an EPA chemical-resistance category selection chart.

All mixers, loaders, and applicators and other handlers must wear: x Long-sleeved shirt and long pants, x Chemical-resistant gloves (except for applicators using groundboom equipment, pilots and flaggers) x Shoes plus socks, and x Protective eyewear (goggles or face shield)

See “ENGINEERING CONTROLS STATEMENT” for additional requirements and exceptions.

Discard clothing and other absorbent materials that have been drenched or heavily contaminated with this product's concentrate. Do not reuse them. Follow manufacturer's instructions for cleaning/maintaining PPE. If no such instructions for washables exist, use detergent and hot water Keep and wash PPE separately from other laundry.

ENGINEERING CONTROLS STATEMENT When handlers use closed systems, enclosed cabs, or aircraft in a manner that meets the requirements listed in the Worker Protection Standard (WPS) for agricultural pesticides [40 CFR 170.240(d)(4-6)], the handler PPE requirements may be reduced or modified as specified in the WPS.

Pilots must use cockpits in a manner that meets the requirements listed in the Worker Protection Standard (WPS) for agricultural pesticides [(40 CFR 170.240(d)(4-6)].

USER SAFETY RECOMMENDATIONS Users should: x Wash hands before eating, drinking, chewing gum, using tobacco or using the toilet. x Remove clothing/PPE immediately if pesticide gets inside. Then wash thoroughly and put on clean clothing. x Remove PPE immediately after handling this product. Wash the outside of gloves before removing. As soon as possible, wash thoroughly and change into clean clothing.

3

ENVIRONMENTAL HAZARDS Do not apply directly to water, or to areas where surface water is present, or to intertidal areas below the mean high water mark. Do not contaminate water when cleaning equipment or disposing of equipment washwaters or rinsate. Apply this product only as directed.

PHYSICAL-CHEMICAL HAZARDS Do not mix or allow coming in contact with an oxidizing agent. A hazardous chemical reaction may occur. DIRECTIONS FOR USE It is a violation of Federal law to use this product in a manner inconsistent with its labeling. Do not apply this product in a way that will contact workers or other persons, either directly or through drift. Only protected handlers may be in the area during application. For any requirements specific to your State or Tribe, consult the agency responsible for pesticide regulation. AGRICULTURAL USE REQUIREMENTS Use this product only in accordance with its labeling and with the Worker Protection Standard, 40 CFR part 170. This Standard contains requirements for the protection of agricultural workers on farms, forests, nurseries, and greenhouses, and handlers of agricultural pesticides. It contains requirements for training, decontamination, notification, and emergency assistance. It also contains specific instructions and exceptions pertaining to the statements on this label about personal protective equipment (PPE) and restricted-entry interval. The requirements in this box only apply to uses of this product that are covered by the Worker Protection Standard.

Do not enter or allow worker entry into treated areas during the restricted-entry interval (REI) of 24 hours.

PPE required for early entry to treated areas that is permitted under the Worker Protection Standard and that involves contact with anything that has been treated, such as plants, soil, or water is:

  1. Coveralls worn over short-sleeved shirt and short pants
  2. Chemical-resistant footwear plus socks
  3. Chemical-resistant gloves made of any waterproof material
  4. Chemical-resistant headgear for overhead exposure
  5. Protective eyewear Notify workers of application by warning them orally and by posting warning signs at entrances to treated area.

NON-AGRICULTURAL USE REQUIREMENTS The requirements in this box apply to uses of this product that are NOT within the scope of the Worker Protection Standard for agricultural pesticides (40 CFR Part 170). The WPS applies when this product is used to produce agricultural plants on farms, forests, nurseries, or greenhouses.

Do not enter or allow others to enter the treated area until sprays have dried.

4 Resistance-Management Recommendations For resistance management, this product is a Group 4 herbicide. Any weed population may contain or develop plants naturally resistant to this product and other Group 4 herbicides. The resistant biotypes may dominate the weed population if these herbicides are used repeated in the same field. Appropriate resistance management strategies should be followed.

To delay herbicide resistance take one or more of the following steps: x Use tank mixtures with herbicides from a different group if such use is permitted; where information on resistance in target weed species is available, use the less resistance-prone partner at a rate that will control the target weed(s) equally as well as the more resistance- prone partner. Consult your local extension service or certified crop advisor if you are unsure as to which active ingredient is currently less prone to resistance. x Adopt an integrated weed-management program for herbicide use that includes scouting and uses historical information related to herbicide use and crop rotation, and that considers tillage (or other mechanical control methods), cultural (e.g. higher crop seedling rates; precision fertilizer application method and timing to favor the crop and not the weeds), biological (weed- competitive crops and varieties) and other management practices. x Contact your local extension specialist or certified crop advisor for additional pesticide resistance-management and/or integrated weed-management recommendations for specific crops and weed biotypes.

PRODUCT INFORMATION The following directions apply to all uses of this product. Additional precautions and restrictions will be found in each specific use section. Do not treat irrigation ditches or water used for crop irrigation or domestic uses. Do not apply this product through any type of irrigation system.

Rates of use of this product must not exceed 2 pints per acre, per application; and 4 pints per acre, per year. Rates of use of dicamba acid equivalent (a.e.) must not exceed a maximum single application rate of 1.0 lb. per acre; and an annual application rate of 2.0 lbs. per acre. These restrictions apply to this product and possible mixtures with other products containing dicamba.

MIXING AND APPLICATION Unless otherwise specified under the individual use headings of this label, the following directions apply to all crop and noncrop uses of this product. Refer to individual use sections for additional precautions, restrictions, application rates and timings.

This product is a water-soluble formulation that can be applied using water or sprayable fluid fertilizer as the carrier. If a fluid fertilizer is to be used, conduct a compatibility test (see “COMPATIBILITY TEST” below) prior to tank mixing.

Use ground or aerial application equipment which will give good spray coverage of weed foliage. However, do not use aerial application equipment if spray particles can be carried by wind into areas where sensitive crops or plants are growing or when temperature inversions exist.

5 Apply 3 to 50 gallons of diluted spray per treated acre when using ground application equipment, or 1 to 10 gallons of diluted spray per treated acre (2 to 20 gallons of diluted spray per acre for preharvest uses) in a water-based carrier when using aerial application equipment. Use the higher level of the listed spray volumes when treating dense or tall vegetation. Use coarse sprays.

Select nozzles designed to produce minimal amounts of fine spray particles. Spray with nozzles as close to the weeds as is practical for good weed coverage.

To avoid uneven spray coverage, do not apply this product during periods of gusty wind or when wind is in excess of 15 mph.

Avoid disturbing (e. g., cultivating or mowing) treated areas for at least 7 days following application.

GROUND AND SURFACE WATERS PROTECTION

  1. Point source contamination: To prevent point source contamination, do not mix or load this pesticide product within 50 feet of wells (including abandoned wells and drainage wells), sink holes, perennial or intermittent streams and rivers, and natural or impounded lakes and reservoirs. Do not apply pesticide product within 50 feet of wells. This setback does not apply to properly capped or plugged abandoned wells and does not apply to impervious pad or properly diked mixing/loading areas as described below.

Mixing, loading, rinsing, or washing operations performed within 50 feet of a well are allowed only when conducted on an impervious pad constructed to withstand the weight of the heaviest load that may be on or move across the pad. The pad must be self-contained to prevent surface water flow over or from the pad. The pad capacity must be maintained at 110% that of the largest pesticide container or application equipment used on the pad and have sufficient capacity to contain all product spills, equipment or container leaks, equipment wash waters, and rainwater that may fall on the pad. The containment capacity does not apply to vehicles delivering pesticide shipments to the mixing/loading site. States may have in effect additional requirements regarding wellhead setbacks and operational containment.

Care must be taken when using this product to prevent: a) back-siphoning into wells, b) spills or c) improper disposal of excess pesticide, spray mixtures or rinsates. Check valves or antisiphoning devices must be used on all mixing equipment.

  1. Movement by surface runoff or through soil: Do not apply under conditions which favor runoff. Do not apply to impervious substrates such as paved or highly compacted surfaces in areas with high potential for ground water contamination. Ground water contamination may occur in areas where soils are permeable or coarse and ground water is near the surface. Do not apply to soils classified as sand with less than 3% organic matter and where ground water depth is shallow. To minimize the possibility of ground water contamination, carefully follow application rate instructions as affected by soil type in the product information section of this label.

6 3) Movement by water erosion of treated soil: Do not apply or incorporate this product through any type of irrigation equipment or by flood or furrow irrigation. Ensure treated areas have received at least one-half inch rainfall (or irrigation) before using tailwater for subsequent irrigation of other fields.

SENSITIVE CROP PRECAUTIONS This product may cause injury to desirable trees and plants, particularly beans, cotton, flowers, fruit trees, grapes, ornamentals, peas, potatoes, soybeans, sunflowers, tobacco, tomatoes, and other broadleaf plants when contacting their roots, stems or foliage. These plants are most sensitive to this product during their development or growing stage. Follow the precautions listed below when using this product. x Do not treat areas where either possible downward movement into the soil or surface washing may cause contact of this product with the roots of desirable plants such as trees and shrubs. x Avoid making applications when spray particles may be carried by air currents to areas where sensitive plants are growing, or when temperature inversions exist. Do not spray near sensitive plants if wind is gusty or in excess of 5 mph and moving in the direction of adjacent sensitive plants. Leave an adequate buffer zone between area to be treated and sensitive plants. Coarse sprays are less likely to drift out of the target area than fine sprays. x Use coarse sprays to avoid potential herbicide drift. Select nozzles which are designed to produce minimal amounts of fine spray particles. Examples of nozzles designed to produce coarse sprays via ground applications are Delavan Raindrops, Spraying Systems XR flat fans or large capacity flood nozzles such as D10, TK10, or greater capacity tips. Keep the spray pressure at or below 20 psi and the spray volume at or above 20 gallons/acre, unless otherwise required by the manufacturer of drift-reducing nozzles. Consult with your spray nozzle supplier concerning the choice of drift-reducing nozzles. x Agriculturally approved drift-reducing additives may be used. x Do not apply this product adjacent to sensitive crops when the temperature on the day of application is expected to exceed 85°F as drift is more likely to occur. x To avoid injury to desirable plants, thoroughly clean equipment used to apply this product (see “PROCEDURE FOR CLEANING SPRAY EQUIPMENT”) before reusing to apply any other chemicals.

All crop uses of this product are intended for a normal growing interval between planting and harvest. No crop rotation restrictions exist if normal harvest of treated crop has occurred. If this interval is shortened, such as in cover crops that will be plowed under, do not follow up with the planting of a sensitive crop.

Crops growing under stress conditions such as drought, poor fertility, or foliar damage due to hail, wind or insects, can exhibit various injury symptoms that may be more pronounced if herbicides are applied. Consult your local or state authorities for possible application restrictions and advice concerning these and other special local use situations. Tank mix instructions are for use only in states where the tank mix product and application site are registered.

7 BAND TREATMENTS This product may be applied as a band treatment. Use the formulas below to determine the appropriate rate and volume per treated acre.

Band width in inches x Broadcast rate per = Band rate per Row width in inches treated acre treated acre

Band width in inches x Broadcast volume = Band volume per Row width in inches per treated acre treated acre

COMPATIBILITY TEST Before mixing in the spray tank, it is advisable to test compatibility by mixing all components in a small container in proportionate quantities (see following table).

Amount of Herbicide to Add to One Pint of Spray Carrier (Assuming Volume is 25 Gallons per Acre) HERBICIDE FORMULATIONS RATE PER ACRE Dry 1 lb. Liquid 1 pt.

If herbicide(s) do not ball-up or form flakes, sludge, gels, oily films or layers, or other precipitates, then the tested spray mix is compatible. Usually, incompatibility in any of the above described forms will occur within 5 minutes after mixing.

If components are incompatible, the use of a compatibility agent is required. Rerun the above “COMPATIBILITY TEST” with a suitable compatibility agent (1/4 teaspoon is equivalent to 2 pints per 100 gallons of fluid fertilizer).

PROCEDURE FOR CLEANING SPRAY EQUIPMENT The steps listed below are suggested for thorough cleaning of spray equipment following applications of this product or tank mixes of this product plus 2,4-D amine:

  1. Hose down thoroughly the inside as well as outside surfaces o f equipment while filling the spray tank half full of water. Flush by operating sprayer until the system is purged of the rinse water.
  2. Fill tank with water while adding 1 quart of household ammoni a for every 25 gallons of water. Operate the pump to circulate the ammonia solution through the sprayer for 15 to 20 minutes and discharge a small amount of the ammonia solution through the boom and nozzles. Let the solution stand for several hours, preferably overnight.
  3. Flush the solution out of the spray tank through the boom.
  4. Remove the nozzles and screens and flush the system with two full tanks of water.
  5. The steps listed below are suggested for thorough cleaning of spray equipment used to apply this product as a tank mix with wettable powders (WP), emulsifiable concentrates (EC), or other types of water-dispersible formulations.

8 6. This product tank mixes with w ater-dispersible formulations require the use of a water/detergent rinse. 7. Complete step 1. 8. Fill tank with water while adding 2 lbs. of detergent for eve ry 40 gallons of water. Operate the pump to circulate the detergent solution through the sprayer system for 5 to 10 minutes and discharge a small amount of the solution through the boom and nozzles. Let the solution stand for several hours, preferably overnight. 9. Flush the detergent solution out of the spray tank through th e boom. 10. Repeat step 1, and follow with steps 2, 3, and 4.

9 WEED LIST This is a list of weeds which may be treated with this product in accordance with this label as required under the “RATES AND TIMINGS” sections of the individual use headings. Proper usage of this product will give control of growth suppression of any annual, biennial, and perennial broadleaf weeds, and many woody brush, tree and vine species including:

ANNUALS Amaranth, Spiny (Spiny Pigweed) Aster, Slender Bedstraw Beggarweed, Florida Broomweed, Common Buckwheat, Wild Buffalobur Burclover, California Burcucumber Buttercup Roughseed Carpetweed Catchfly, Nightflowering Chamomile, Corn Chickweed, Common Clovers (Annual) Cockle, Corn Cockle, Cow Cocklebur, Common Croton, Tropic Croton, Woolly Daisy, English Evening Primrose, Cutleaf Fleabane, Annual Goosefoot, Nettleleaf Henbit Jimsonweed Knotweed Kochia Ladysthumb Lambsquarters, Common Lambsquarters (triazine- resistant) Lettuce, Prickly Mallow, Common Mallow, Venice Mare's Tail (Horseweed) Mayweed Morningglory, Ivyleaf Morningglory, Tall Pennycress, Field (Fanweed, Frenchweed, Stinkweed) Pepperweed, Virginia (Peppergrass) Pigweed, Prostrate Pigweed, Redroot (Carelessweed) Pigweed, Rough Pigweed, Smooth Pigweed (triazine-resistant) Pigweed, Tumble Poorjoe Puncturevine Purslane, Common Pusley, Florida Radish, Wild Ragweed, Common Ragweed, Giant (Buffaloweed) Ragweed, Lance-Leaf Rubberweed, Bitter (Bitterweed) Sesbania, Hemp Shepherdspurse Sicklepod Sida, Prickly (Teaweed) Smartweed, Green Smartweed, Pennsylvania Sneezeweed, Bitter Sowthistle, Annual Sowthistle, Spiny Spikeweed, Common Spurge, Prostrate Spurry, Corn Starbur, Bristly Sumpweed, Rough Sunflower, Common (Wild) Sunflower, Volunteer Thistle, Russian Velvetleaf Waterhemp Waterprimrose, Winged Wormwood, Annual

BIENNIALS Burdock, Common Carrot, Wild (Queen Anne's Lace) Cockle, White Evening Primrose, Common Geranium, Carolina Gromwell Knapweed, Diffuse Knapweed, Spotted Mallow, Dwarf Plantain, Bracted Ragwort, Tansy Starthistle, Yellow Sweetclover Teasel Thistle, Bull Thistle, Milk Thistle, Musk Thistle, Plumeless

PERENNIALS *Alfalfa Artichoke, Jerusalem Aster, Spiny Aster, Whiteheath Beadstraw, Smooth Bindweed, Field Bindweed, Hedge Blueweed, Texas *Bursage (Bur Ragweed, Lakeweed, Povertyweed) Bursage, Woollyleaf (Lakeweed) Buttercup, Tall Campion, Bladder Chickweed, Field Chickweed (Mouseear, Canada) Chicory *Clover, Hop *Dandelion, Common *Dock, Broadleaf (Bitterdock) *Dock, Curly Dogbane, Hemp *Dogfennel (Cypressweed) Fern, Bracken Garlic, Wild Goldenrod, Canada Goldenrod, Missouri Goldenweed, Common Hawkweed Henbane, Black Horsenettle, Carolina Ironweed Knapweed, Black Knapweed, Russian

Milkweed, Climbing Milkweed, Common Milkweed, Honeyvine Milkweed, Western Whorled Nettle, Stinging Nightshade, Silverleaf (White Horsenettle) Onion, Wild *Plantain, Broadleaf Plantain, Buckhorn Pokeweed Ragweed, Western Redvine Sericia Lespedeza Smartweed, Swamp Snakeweed, Broom *Sorrel, Red (Sheep Sorrel) Sowthistle Sowthistle, Perennial Spurge, Leafy Sundrop, Halfshrub (Evening Primrose) Thistle, Canada Toadflex, Dalmation Tropical Soda Apple Trumpetcreeper (Buckvine) Vetch Waterhemlock Waterprimrose, Creeping *Woodsorrel, Creeping Common Yellow Wormwood, Common Wormwood, Louisiana *Yankeeweed Yarrow, Common

Perennials noted with an asterisk (*) may be controlled using this product at rates lower than those for other listed perennial weeds (See “RATES AND TIMINGS” sections in this label).

10 WOODY BRUSH, TREES, & VINES Alder Ash Aspen Basswood Beech Birch *Blackberry *Blackgum *Cedar Cherry Chinquapin Cottonwood *Creosotebush Cucumbertree

  • Growth Suppression

*Dewberry *Dogwood Elm Grape *Hawthorn, (Thornapple) Hemlock Hickory Honeylocust Honeysuckle Hornbeam Huckleberry Huisache Ivy, Poison Kudzu Locust, Black Maple Mesquite Oak Oak, Poison Olive, Russian Persimmon, Eastern Pine *Plum Sand (Wild Plum) Poplar Rabbitbrush *Redcedar, Eastern *Rose, McCartney *Rose, Multiflora Sagebrush, Fringe Sassafras Serviceberry Spicebush Spruce Sumac *Sweetgum Sycamore Tarbush Willow Witchhazel Yaupon Yucca FIELD, SEED, POPCORN AND SILAGE CORN *Do not apply this product to seed corn or popcorn without first verifying with your local seed corn company (supplier) this product’s selectivity on your inbred line or variety of popcorn. This precaution will help avoid potential injury of sensitive varieties.

Observe all precautions, restrictions, and mixing and application instructions.

This product is not registered for use on sweet corn.

Direct contact of this product with corn seed must be avoided. If corn seeds are less than 1-1/2 inches below the surface, delay application until corn has emerged.

Up to 2 applications of this product may be made during a growing season. Do not exceed a total of 1-1/2 pints of this product per treated acre per crop year. Allow two weeks or more between applications. See appropriate section for rate information. For combination options or sequential treatments, refer to appropriate section.

This product contains 0.5 pounds a.e. of dicamba per pint. When tank mixing with products that contain dicamba, do not exceed a combined total of 1.0 pound of a.e. per acre, per application.

Applications of this product to corn during periods of rapid growth may result in temporary leaning. Corn will usually become erect within 3 to 7 days. To avoid breakage, delay cultivation until after corn is growing normally.

Agriculturally-approved surfactants or sprayable fertilizers (1/2 to 1 gallon per acre of 28%, 30% or 32% urea ammonium nitrate or 2.5 pounds per acre spray grade ammonium sulfate

  1. may be added to the spray mixture to improve post-emergence weed control, particularly in dry growing conditions. 1 Not for use in California.

11 Do not use adjuvants containing penetrants such as petroleum-based oils after crop emergence or crop injury may result.

Once the crop has reached ensilage (milk) stage or later in maturity, corn can be harvested or grazed for feed.

Several synthetic pyrethroid insecticides are labeled for tank mix applications of this product. Refer to their label for specific instructions.

WEEDS CONTROLLED This product will control many annual broadleaf weeds or give growth suppression of many perennial broadleaf weeds commonly found in corn (Refer to the “WEED LIST”).

For best performance, make application when weeds have emerged and are actively growing.

Preemergence control of cocklebur, velvetleaf, and jimsonweed may be reduced if conditions such as low temperature or lack of soil moisture cause delayed or deep germination of weeds.

PREPLANT/PREEMERGENCE IN NO-TILLAGE CORN Applications of this product may be made before, during, or after planting to emerged and actively growing broadleaf weeds. Apply this product at 1 pint per treated acre on medium or fine textured soils containing 2% or greater organic matter. Use 1/2 pint per treated acre on coarse-textured soils (sand, sandy loam, and loamy sand) or medium and fine textured soils with less than 2% organic matter.

When planting into a legume sod (e.g., alfalfa or clover), apply this product after 4 to 6 inches of regrowth has occurred.

PREEMERGENCE IN CONVENTIONAL OR REDUCED TILLAGE CORN This product may be applied after planting and prior to corn emergence. Application at 1 pint per treated acre may be made to medium or fine textured soils which contain 2% or greater organic matter. DO NOT apply to coarse textured soils (sand, sandy loam, and loamy sand) until after crop emergence (see “EARLY POSTEMERGENCE” uses below).

Preemergence application of this product does not require mechanical incorporation to become active. A shallow mechanical incorporation is required if application is not followed by adequate rainfall or sprinkler irrigation. Avoid tillage equipment (e.g., drags, harrows) which concentrates treated soil over seed furrow.

EARLY POSTEMERGENCE (ALL TILLAGE SYSTEMS) (SPIKE THROUGH 8-INCH-TALL CORN) This product at 1 pint per treated acre may be applied during the period from corn emergence through the five-leaf stage or 8 inches tall, whichever comes first. Reduce the rate to 1/2 pint per treated acre if corn is growing on coarse textured soils (sand, sandy loam, and loamy sand). See “LATE

12 POSTEMERGENCE APPLICATIONS” given below if the 6th true leaf is emerging from whorl or corn is greater than 8 inches tall.

LATE POSTEMERGENCE (ALL TILLAGE SYSTEMS) (8- TO 36-INCH TALL CORN) Application of this product at 1/2 pint per treated acre may be made from 8- to 36-inch tall corn or 15 days before tassel emergence, whichever comes first. For best performance, make applications when weeds are less than 3 inches tall.

Make directed spray application when (1) corn leaves prevent proper spray coverage; (2) sensitive crops are growing nearby, and (3) tank mixing with 2,4-D.

DO NOT apply this product when soybeans are growing nearby if any of these conditions exist: x corn is more than 24 inches tall x soybeans are more than 10 inches tall x soybeans have begun to bloom

OVERLAY (SEQUENTIAL) TREATMENTS This product may be applied to ground previously treated with one or more of the following herbicides:

acetochlor (SurpassTM, Harness® Plus) alachlor (Lasso®, Lasso® MT, Partner®) atrazine BroadstrikeTM + Dual® BroadstrikeTM Plus Bullet® butylate (Sutan® +) Clarity® dimethenamid (Frontier®) EPTC (Eradicane®) glyphosate (AgSaver™ Glyphosate 41% Plus, Gly Star™ Original, Roundup®) Guardsman® halosulfuron (Battalion®, Permit®) Lariat® dicamba plus atrazine (Dicambazine™) Metolachlor paraquat (Gramoxone®) pendimethalin (Prowl®) propachlor (Ramrod®) simazine (Princep®)

Apply this product at 1/2 pint per treated acre to ground previously treated with full rates of Clarity® or Dicamba plus Atrazine herbicides. Allow at least 2 weeks between applications.

Read and follow label directions for each of the above products.

TANK MIX TREATMENTS FOR CORN This product may be tank mixed with one or more of the following herbicides for control of grasses or additional broadleaf weeds. Read and follow the label of each tank mix product used for precautionary statements, directions for use, rates and timings, and other restrictions.

RATES AND TIMINGS

13 DICAMBA 48.2% Plus Preplant Pre- emergent (No Tillage Corn) Pre-emergent (Conventional or Reduced Tillage Corn) Early Post- emergent (All Tillage Systems) Late Post-emergent (All Tillage Systems) Additional Directions ACCENT® (nicosulfuron) 1/2 to 1 oz. a.i. /A 1/2 to 1 oz. a.i. /A. To improve spray coverage of weeds and reduce risk of corn injury, use drop pipes to direct spray beneath corn leaves when corn is greater than 8 inches tall Application may be made to emerged weeds before corn is greater than 24 inches tall. Use non-ionic surfactant at 0.25% (v/v) with this tank mixture Atrazine 1-1/4 to 2 lbs. a.i. /A 1-1/4 to 2 lbs. a.i. /A 1-1/4 to 2 lbs. a.i. /A Crop oil concentrate may be used with this mixture if corn is 5 inches or less in height 1-1/4 to 2 lbs. a.i. /A Do not apply if corn is greater than 12 inches tall Application may be made before grasses are 1-1/2 inches tall. Follow all State and Federal restrictions pertaining to atrazine applications BEACON® (primisulfuron) 0.31 to 0.62 oz. a.i. /A 0.31 to 0.62 oz. a.i. /A To improve spray coverage of weeds and reduce risk of corn injury, use drop pipes to direct spray beneath corn leaves when corn is greater than 8 inches tall Application may be made to emerged weeds when corn is 4 to 24 inches tall. Use non-ionic surfactant at 0.25% (v/v) with this tank mixture DUAL II MAGNUM S-metolachlor 1 to 2 lbs. a.i. /A 1 to 2 lbs. a.i. /A Use only on fine or medium textured soils with 2.5% or greater organic matter 1 to 2 lbs. a.i. /A Application may be made before grasses reach the 2-leaf stage and before corn is greater than 3 inches tall FRONTIER® (dimethenamid) 13 to 25 fl. oz. a.i. /A 13 to 25 fl. oz. a.i. /A Use only on fine or medium textured soils with 2.5% or greater organic matter 13 to 25 fl. oz. a.i. /A Application may be made up to 8-inch tall corn. This treatment must be combined with a herbicide that provides postemergence control of grass weeds if they are greater than 1-inch tall at the time of application FRONTIER® 6.0 (dimethenamid)

16 to 32 fl. oz. a.i./A 16 to 32 fl. oz. a.i./A Use only on fine or medium textured soils with 2.5% or greater organic matter 16 to 32 fl. oz. a.i./A Application may be made up to 8-inch tall corn. This treatment must be combined with a herbicide that provides postemergence control of grass weeds if they are greater than 1-inch tall at the time of application GRAMOXONE® (paraquat) 1/4 to 1 lb. a.i. /A 1/4 to 1 lb. a.i. /A Application may be made to emerged weeds but prior to corn emergence HARNESS® PLUS or SURPASS™ (acetochlor) 1-1/2 to 3 lbs. a.i. /A 1-1/2 to 3 lbs. a.i. /A Use only on fine or medium textured soils with 2.5% or greater organic matter Apply prior to corn emergence

14 DICAMBA 48.2% Plus Preplant Pre- emergent (No Tillage Corn) Pre-emergent (Conventional or Reduced Tillage Corn) Early Post- emergent (All Tillage Systems) Late Post-emergent (All Tillage Systems) Additional Directions LASSO® (alachlor) 1-1/2 to 4 lbs. a.i. /A 1-1/2 to 4 lbs. a.i. /A Use only on fine textured soils with greater than 2.5% organic matter 1-1/2 to 4 lbs. a.i. /A Application may be made before grasses reach the 2-leaf stage and before corn is greater than 3 inches tall. If microencapsulated forms of alachlor are used (Lasso® MT, Partner®), applications must be made prior to grass emergence PRINCEP® (simazine) 2 to 3 lbs. a.i. /A 2 to 3 lbs. a.i. /A Application may be made prior to corn or weed emergence PROWL® (pendimethalin ) 3/4 to 1-1/2 lbs. a.i. /A Use only on fine or medium textured soils with 2.5% or greater organic matter 3/4 to 1-1/2 lbs. a.i./A Application may be made immediately after planting but prior to weed emergence, but not beyond the 2-leaf stage of growth. AGSAVER™ GLYPHOSATE 41% PLUS or GLY STAR® ORIGINAL or ROUNDUP® (glyphosate) 1 to 3 lbs. a.i. /A 1 to 3 lbs. a.i. /A Application may be made to emerged weeds but prior to corn emergence. STINGER.TM (clopyralid) 0.035 to 0.07 lbs. a.i. /A 0.035 to 0.07 lbs. a.i. /A Application may be made any time after corn emergence through 24-inch tall corn. Use drop nozzles to direct spray after corn exceeds the 8-inch stage. Apply when the majority of the thistle plants have emerged and are at least 4-inches in height, but before bud stage. Use higher rates listed for stand reduction of larger thistle plants or heavier infestations. Lower rates listed may provide seasonal thistle suppression only. TOUGH® 3.75 EC (pyridate) 0.47 lb. a.i. /A 0.47 to 0.94 lb. a.i. /A Applications may be made to emerged, actively growing weeds. Directed applications are required when corn is large enough to prevent proper spray coverage. 2,4 D 1/4 to 1/2 lb. a.i. /A 1/4 to 1/2 lb. a.i. /A Do not apply 1/8 lb. a.i. /A Drop pipes are to be used when corn height is 8 inches or greater. Keeping the spray off the corn leaves and out of the whorl will reduce the likelihood of crop injury and improve spray coverage of weed foliage

SORGHUM (MILO) Observe all precautions and restrictions, including the reference to crops growing under stress.

Read and follow “MIXING AND APPLICATION” instructions.

x Applications of this product to sorghum during periods of rapid growth may result in temporary leaning of plants or rolling of leaves. These effects are usually outgrown within 10 to 14 days.

15 x Do not graze or feed treated sorghum forage or silage prior to mature grain stage. If sorghum is grown for pasture or hay, refer to the “PASTURE” use section. x Do not apply this product to sorghum grown for seed production. x Make no more than one application per growing season. x Do not apply within 30 days of harvest of sorghum grain or sorghum fodder.

This product contains 0.5 pounds a.e. of dicamba per pint. When tank mixing with products that contain dicamba, do not exceed a combined total of 1.0 pound of a.e. per acre per application.

WEEDS CONTROLLED This product, when applied at the label rate for sorghum, will control many actively growing annual broadleaf weeds and will reduce competition from established perennial broadleaf weeds as well as control their seedlings (Refer to “WEED LIST”).

RATES AND TIMINGS This product may be applied to emerged and actively growing weeds at least 15 days prior to planting. Postemergence application of this product must be made after sorghum is in the spike stage (all sorghum emerged) but before sorghum is 15 inches tall. For best performance, make applications when sorghum is in the 3 to 5 leaf stage and weeds are small (less than 3 inches tall). Use drop pipes (drop nozzles) if sorghum is taller than 8 inches. Keeping the spray off the sorghum leaves and out of the whorl will reduce the likelihood of crop injury and improve spray coverage of weed foliage.

BROADCAST RATE PER TREATED ACRE 1/2 pint (1/4 lb. a.i.)

TANK MIX TREATMENTS THIS PRODUCT PLUS ATRAZINE For improved control of emerged, actively growing broadleaf weeds including triazine-resistant species and added suppression of perennial broadleaf weeds, tank mix 1/2 pint of this product with 0.5 to 1.25 lbs. a.i. atrazine per treated acre. For control of grasses (less than 1.5 inches tall), tank mix 1/2 pint this product with 2 lbs. a.i. atrazine per treated acre. For best performance and minimal crop injury, make application when sorghum is 3 to 8 inches tall and when broadleaf weeds are small (less than 6 inches tall). Application of atrazine must be made before sorghum is beyond 12 inches tall. The atrazine rate will depend upon soil texture and length of residual weed control desired. Follow all State and Federal restrictions pertaining to atrazine applications.

THIS PRODUCT PLUS BROX TM 2EC HERBICIDE or BUCTRIL® For improved control of broadleaf weeds, tank mix 1/2 pint this product with 1 to 1-1/2 pints BROX™ 2EC Herbicide or Buctril® per treated acre. Make application at 4-leaf to 15-inch tall sorghum. Use drop nozzles to direct spray beneath sorghum leaves when sorghum is greater than 8-inches tall.

Read and follow the label of each tank mix product used for precautionary statements, directions for use, application rates and timings and other restrictions.

16 OVERLAY (SEQUENTIAL) TREATMENTS This product may be applied to ground previously treated with one or more of the following herbicides registered for use in sorghum: Herbicide Maximum Rate Per Treated Acre (lbs. a.i.) alachlor (Lasso®) (Screen®-treated seed) 4.00 atrazine1 2.50 metolachlor (Concep®-treated seed) 1.67 propachlor (Ramrod®) 5.00 1 Maximum use rate for atrazine is determined by soil type, tillage practices, surface residue, and state or local restrictions. Follow the more restrictive label requirements when determining the maximum use rate for atrazine.

PREHARVEST USES (FOR USE ONLY IN THE STATES OF TEXAS AND OKLAHOMA) This product may be applied for weed suppression any time after the sorghum has reached the soft dough stage. An agriculturally approved surfactant may be used to improve performance. For aerial application use at least 2 gallons of water-based carrier per treated acre.

Do not harvest until 30 days after treatment.

BROADCAST RATE PER TREATED ACRE 1/2 pint (1/4 lb. a.i.)

SMALL GRAINS (WHEAT, BARLEY AND OATS) NOT UNDERSEEDED TO LEGUMES Observe all precautions and restrictions. Read and follow cleaning, mixing and application instructions.

Do not apply within 7 days of harvest for wheat, barley or oat for grain. If small grains are used for pasture or hay, the following restrictions apply: x Animals cannot be removed from treated area for slaughter prior to 30 days after last application. x There is no waiting period between treatment and grazing for non-lactating dairy animals. x Treated areas may not be grazed by lactating dairy animals before 7 days after treatment. x Do not harvest hay from treated areas before 37 days after treatment.

This product contains 0.5 pounds a.e. of dicamba per pint. When tank mixing with products that contain dicamba, do not exceed a combined total of 1.0 pound of a.e. per acre per application.

17 WEEDS CONTROLLED This product or combinations with listed tank mix partners will provide control or suppression of the annual broadleaf weeds listed below. For improved control of listed weeds, this product may be applied in a tank mix with other herbicides. Refer to specific crop for tank mix options. Alkanet1 Bedstraw, Catchweed1 Bindweed, Field2 Buckwheat, Tartary Buckwheat, Wild Carpetweed1 Chamomile, Corn Chervil, Bur1 Chickweed, Common1 Cockle, Corn Cockle, Cow Cocklebur, Common Cornflower (Bachelorbutton) 1 Dandelion, Common2 Dock, Curly2 Dragonhead, American1 Evening Primrose, Cutleaf1 Falseflax, Smallseeded1 Fiddleneck (Tarweed) 1 Flixweed1 Fumitory1 Gromwell, Corn1 Groundsel, Common1 Hempnettle1 Henbit Jacobs Ladder1 Knawel (German Moss) Knotweed, Prostrate Kochia Ladysthumb Lambsquarters, Common Lettuce, Miners1 Lettuce, Prickly Mallow, Common Mayweed, Chamomile (Dogfennel)1 Pepperweed, Peppergrass1 Mustard, Blue (Purple)1 Mustard, Tansy Mustard, Treacle1 Mustard, Tumble (Jim Hill)1 Mustard, Wild1 Nightshade, Black Nightshade, Cutleaf' Nightshade, Silverleaf2 (White Horsenettle) Pennycress, Field (Fanweed, Frenchweed, Stinkweed) Pigweed, Redroot (Carelessweed) Pigweed, Rough Pigweed, Tumble Pineappleweed1 Plantain, Broadleaf2 Poppy, Red Horned1 Puncturevine1 Purslane, Common1 Radish, Wild1 Ragweed, Common1 Ragweed, Giant (Buffaloweed)1 Rocket, London1 Rocket, Yellow1 Salsify (Goatsbeard)1 Shepherdspurse1 Smartweed, Green Smartweed, Pennsylvania Sorrel, Red (Sheep Sorrel)1 Sowthistle, Annual Starthistle, Yellow1 Sunflower, Common (Wild) Thistle, Canada2 Thistle, Russian Velvetleaf Vetch1 Yarrow, Common2

1 These weeds will be controlled with this product tank mixtures. Refer to tank mix label for specific weeds controlled. 2 This product tank mixes will provide suppression of established broadleaf weeds and control of their seedlings. RATES AND TIMINGS Application of this product may be made before, during or after planting of small grains. For best performance, make applications when weeds are in the 2 to 3 leaf stage and rosettes are less than 2 inches across. Application of this product to small grains during periods of rapid growth may result in crop leaning. This condition is temporary and will not reduce crop yields.

Use this product at 2 to 4 fluid ounces per treated acre in wheat, fall-seeded barley, and oats, and at 2 to 3 fluid ounces per treated acre in spring-seeded barley. Use the higher level of listed rate ranges when treating difficult to control weeds such as kochia, Russian thistle and prickly lettuce or dense vegetative growth.

18

This product used in a tank mix with other herbicides offers the best spectrum of weed control and herbicide tolerant or resistant weed management. Refer to specific crop for this product rate and application timing.

For applications prior to the emergence of weeds or when sulfonylurea-resistant weeds are present or suspected, use a minimum of 3 fluid ounces per treated acre of this product with a tank mix herbicide. Non-sulfonylurea herbicides, such as 2,4-D or MCPA tank mixed with this product will offer more consistent control of sulfonylurea resistant weeds.

When tank mixing with sulfonylurea herbicides, such as Ally®, Amber®, Express®, Finesse®, Glean® and Harmony® Extra, use an agriculturally approved surfactant of at least 80% active ingredient at the rate of 1 to 4 pints/100 gallons of spray or not more than 0.25 to 0.5% by volume. Use the highest rate of surfactant when using the lower rate ranges of the tank mix and/or when treating more mature and difficult to control weeds or dense vegetative growth.

FALL- AND SPRING-SEEDED WHEAT This product must be applied to fall-seeded wheat prior to the jointing stage. Applications to spring- seeded wheat must be made before wheat reaches the 6-leaf stage.

TANK MIX TREATMENTS This product may be tank mixed with one or more of the following herbicides. Read and follow the label of each tank mix product used for precautionary statements, directions for use, weeds controlled, and geographic and other restrictions.

BROADCAST RATE PER TREATED ACRE 1 Apply 2 to 4 fluid ounces this product with: Product Active Ingredient Formul ation Amount of Product Per Acr e 2,4-D amine or ester 2,4-D 4 lbs./gal. 8 to 12 fl. oz. (0.25 to 0.375 lb. a.i. /A)2 MCPA amine or ester® MCPA 4 lbs./gal. 8 to 12 fl. oz. (0.25 to 0.375 lb. a.i./A)2 Ally® metsulfuron-methyl 60% DF 1/10 oz. Amber® triasulfuron 75% DF 0.28 oz. Express® thifensulfuron + tribenuron- methyl 75% DF 1/6 oz. Finesse® chlorsulfuron + metsulfuron- methyl 75% DF 1/3 oz. Glean® Chlorsulfuron 75% DF 1/6 oz. Harmony® Extra Thifensulfuron + tribenuron- methyl 75% DF 1/3 oz. BROXTM 2EC Herbicide, Buctril® bromoxynil3 2 lbs./gal. 1 to 1-1/2 pts. BROXTM-M Herbicide, Bronate® bromoxynil + MCPA 4 lbs./gal. 1 to 2 pts.

19 CurtailTM clopyralid + 2,4-D 2.38 lbs./gal. 2 to 2-2/3 pts. Stinger™ clopyralid 3 lbs./gal. 1/4 to 1/3 pt. Karmex®4 d i u r o n 3 80% DF 1/2 to 1-1/2 lbs. Sencor®4 m e t r i b u z i n 3 75% DF 1 to 10 oz. Dakota®5 fenoxaprop-ethyl + MCPA 3.1 lbs./gal. 16 oz. Tiller®5 fenoxaprop-ethyl + MCPA + 2,4-D 2.7 lbs./gal 1 to 1.7 pts. 1 Early developing wheat varietie s such as TAM 107, MADISON, OR WAKEFIELD must receive application between early tillering and the jointing stage. Take care in staging these varieties to be certain that the application occurs prior to the jointing stage. 2 When using formulations other than 4 lb./gal., use pounds active/acre listed. 3 Herbicides with the same active ingredient and/or different formulations may be used. 4 Tank mixtures for fall-seeded wheat only. 5 Use 2 fluid ounces of this product only. Do not use if wild oats is the target weed. Do not use this product as a tank mix treatment with Dakota® or Tiller® on Durum wheat.

SPECIAL USE TANK MIXES FOR SPRING- AND FALL-SEEDED WHEAT (SEE FOOTNOTES FOR APPLICABLE USES)

Apply 3 to 41 fluid ounces this product with: PRODUCT 2 ACTIVE INGREDIENT FORMULATION AMOUNT OF PRODUCT PER ACRE 2,4-D or MCPA amine 2,4- D or MCPA 4.0 lbs./gal. 1 to 2 pts.3 (0.5 to 1.0 lb. a.i. /A)4 2,4-D or MCPA ester 2,4- D or MCPA 4.0 lbs./gal. 1 to 1-1/2 pts.3 (0.5 to 0.75 lb. a.i. /A)4 Ally® metsulfuron-methyl 60% DF 1/20 to 1/10 oz. Amber® triasulfuron 75% DF 0.14 to 0.28 oz. Express® thifensulfuron + tribenuron- methyl 75% DF 1/12 to 1/6 oz. Finesse® chlorsulfuron + metsulfuron- methyl 75% DF 1/6 to 1/3 oz. Glean® chlorsulfuron 75% DF 1/6 oz. Harmony® Extra thifensulfuron + tribenuron- methyl 75% DF 1/6 to 1/3 oz. Ally® + 2,4-D amine or ester5 metsulfuron-methyl + 2,4-D 60% DF + 4 lbs./gal. 1/20 to 1/10 oz . + 8 fl. oz. Amber® + 2,4-D amine or ester5 triasulfuron + 2,4-D 75% DF + 4 lbs./gal. 0.14 to 0.28 oz. + 8 fl. oz. Express® + 2,4-D amine or ester5 (thifensulfuron + tribenuron- methyl) + 2,4-D 75% DF + 4 lbs./gal. 1/12 to 1/6 oz. + 8 fl. oz. Finesse® + 2,4-D amine or ester5 (chlorsulfuron + metsulfuron- methyl) + 2,4-D 75% DF + 4 lbs./gal. 1/6 to 1/3 oz. + 8 fl. oz. Glean® + 2,4-D amine or ester5 chlorsulfuron + 2,4-D 75% DF + 4 lbs./gal. 1/6 oz. + 8 fl. oz. Harmony® Extra + 2,4- D amine or ester5 (thifensulfuron + tribenuron- methyl) + 2,4-D 75% DF + 4 lbs./gal. 1/6 to 1/3 oz. + 8 fl. oz.

20 PRODUCT 2 ACTIVE INGREDIENT FORMULATION AMOUNT OF PRODUCT PER ACRE AgSaver™ Glyphosate 41% Plus or Roundup® RT6 glyphosate 3.0 lbs./gal. 12 to 16 fl. oz. 1 Apply this product up to 6 fluid ounces on fall-seeded wheat in western Oregon as a spring application only. In CO, KS, NM, OK and TX apply up to 8 fluid ounces of this product on fall-seeded wheat after it exceeds the 3-leaf stage for suppression of perennial weeds, such as field bindweed. Applications may be made in fall following a frost but must occur before a killing freeze. This product may be tank mixed with 2,4-D amine at 8 fluid ounces after wheat begins to tiller. Periods of extended stress, such as cold and wet weather, may enhance the possibility of crop injury. For fall applications only, do not use if the potential for crop injury is not acceptable. 2 Do not use low rates of sulfonylurea herbicides, such as Ally®, Amber®, Express®, Finesse®, Glean®, and Harmony® Extra, on more mature weeds and/or on dense vegetative growth. 3 For use on Fall-Seeded Wheat Only. Do not use unless potential crop injury will be acceptable. 4 When using formulations other than 4 lbs./gal., use pounds active/acre listed. 5 Use for improved control of Russian thistle, flixweed, gromwell, mayweed and fiddleneck. 6 This product may be applied at 2 fluid ounces with AgSaver™ Glyphosate 41% Plus or Roundup® RT or any glyphosate formulation labeled for use as a preplant application to small grains with no waiting period prior to planting. Read and follow label directions of the tank mix product for adjuvant use instructions.

FALL- AND SPRING-SEEDED BARLEY This product must be applied to fall-seeded barley prior to the jointing stage.

For spring-seeded barley varieties that are seeded during the winter months or later, follow the rates and timings given for spring-seeded barley.

TANK MIX TREATMENTS This product may be tank mixed with one or more of the following herbicides. Read and follow the label of each tank mix product used for precautionary statements, directions for use, weeds controlled, geographic and other restrictions.

BROADCAST RATE PER TREATED ACRE Apply 2 to 4 fluid ounces this product with: Product1 Active Ingredient Formulation Amount of Product Per Acre 2,4-D amine or ester 2,4-D 4 lb./gal. 8 fl. oz. (0.25 lb. a.i./A)2 MCPA amine or ester MCPA 4 lb./gal. 8 to 12 fl. oz. (0.25 to 0.375 lb. a.i. /A) Ally® metsulfuron-methyl 60% DF 1/20 to 1/10 oz. Amber® triasulfuron 75% DF 0.14 to 0.28 oz. Express® thifensulfuron + tribenuron-methyl 75% DF 1/12 to 1/6 oz. Finesse® chlorsulfuron + metsulfuron-methyl 75% DF 1/6 to 1/3 oz. Glean® chlorsulfuron 75% DF 1/6 oz. Harmony® Extra thifensulfuron + tribenuron-methyl 75% DF 1/6 to 1/3 oz. Sencor® m e t r i b u z i n 3 75% DF 1 to 10 oz. BROX™ 2EC Herbicide, Buctril® bromoxynil 2 lb./gal. 1 to 1-1/2 pts.

21 Product1 Active Ingredient Formulation Amount of Product Per Acre BROX™-M Herbicide, Bronate® bromoxynil + MCPA 4 lb./gal. 3/4 to 1-1/2 pts. 1 Do not use low rates of sulfonylureas (Ally®, Amber®, Express®, Glean®, and Harmony Extra) on more mature weeds and/or on dense vegetative growth. 2 When using formulations other than 4 lb. /gal., use pounds active/acre listed. 3 Herbicides with the same active ingredient and/or different formulations may be used.

SPRING-SEEDED BARLEY This product must be applied before spring-seeded barley exceeds the 4-leaf stage.

TANK MIX TREATMENTS This product may be tank mixed with one or more of the following herbicides. Read and follow the label of each tank mix product used for precautionary statements, directions for use, weeds controlled, geographic and other restrictions.

BROADCAST RATE PER TREATED ACRE Apply 2 to 3 fluid ounces of this product with: PRODUCT1 ACTIVE INGREDIENT FORMULATION AMOUNT OF PRODUCT PER ACRE MCPA amine or ester MCPA 4 lbs./gal. 8 to 12 fl. oz. (0.25 to 0.375 lb. a.i. /A) 2 Ally® metsulfuron-methyl 60% DF 1/20 to 1/10 oz. Amber® triasulfuron 75% DF 0.14 to 0.28 oz. Express® thifensulfuron + tribenuron- methyl 75% DF 1/12 to 1/6 oz. Finesse® chlorsulfuron + metsulfuron- methyl 75% DF 1/6 to 1/3 oz. Glean® chlorsulfuron 75% DF 1/6 oz. Harmony® Extra thifensulfuron + tribenuron- methyl 75% DF 1/6 to 1/3 oz. Sencor® m e t r i b u z i n 3 75% DF 1 to 10 oz. BROX™ 2EC Herbicide, Buctril® bromoxynil 2 lbs./gal. 1 to 1-1/2 pts. BROX™-M Herbicide, Bronate® bromoxynil + MCPA 4 lbs./gal. 3/4 to 1-1/2 pts. 1 D o no t us e l ow r a te s of s ul fo nyl ur e a s ( A l l y® , A m be r® , Ex pr e s s® , G le a n® , a nd H a r m o ny® Ex t r a ) o n m o r e m a t ur e we e ds and/or on dense vegetative growth. 2 When using formulations other than 4 lb. /gal., use pounds active/acre listed. 3 Herbicides with the same active ingredient and/or different formulations may be used.

FALL- AND SPRING-SEEDED OATS This product must be applied before spring-seeded oats exceed the 5-leaf stage. Applications to fall- seeded oats must be made prior to the jointing stage.

TANK MIX TREATMENTS This product may be tank mixed with one or more of the following herbicides. Read and follow the label of each tank mix product used for precautionary statements, directions for use, weeds controlled, geographic and other restrictions.

22

BROADCAST RATE PER TREATED ACRE

Apply 2 to 4 fluid ounces of this product with: Product Active Ingredient Formul ation Amount of Product Per Acr e MCPA amine or ester MCPA 4 lbs. /gal. 8 to 12 fl. oz. (0.25 to 0.375 lb. a.i. /A)1 1 When using formulations other than 4 lbs./gal., use pounds acti ve/acre listed.

SUGARCANE Observe all precautions and restrictions. Read and follow “MIXING AND APPLICATION” instructions. Do not apply within 87 days of harvest. Consult your local or state authorities for possible applicatio n restrictions, especially concerning aerial applications and advice concerning special local use situations.

WEEDS CONTROLLED This product, when applied at the label rates, will control man y annual, biennial and perennial broadleaf weeds commonly found in sugarcane (Refer to “WEED LIST”).

RATES AND TIMINGS Application of this product may be made any time after weeds ha ve emerged and are actively growing but before the close-in stage of sugarcane. Application rates a nd timings of this product are given below. Use the higher level of listed rate ranges when treating dense vegetative growth.

Weed Stage & Type Product Amount Broadcast Rate Per Treated Acr e (lbs. a.i.) Annual Small, actively growing: Established growth: 1/2 to 1 pt. 1 to 1-1/2 pts. 1/4 to 1/2 1/2 to 3/4 Biennial 1 to 2 pts. 1/2 to 1 Perennial 2 to 4 pts. 1 to 2 *

  • Application made over the top of actively growing sugarcane may result in crop injury.

When possible, direct the spray beneath the sugarcane canopy in order to minimize the likelihood of crop injury. The use of directed sprays will also aid in maximizing spray coverage of weed foliage.

Retreatments may be made as needed; however, do not exceed a total of 4 pints (2 lbs. a.i.) of this product per treated acre during a growing season.

TANK MIX TREATMENTS This product may be tank mixed with one or more of the following herbicides for control of grasses or additional broadleaf weeds. Read and follow the label of each tank mix product used for precautionary statements, directions for use, rates and timings, weeds controlled, geographic and other restrictions.

Herbicide Rate Per Treated Acre (lbs. a.i. ) ametryn (Evik®) 2/5 to 8

23 asulam (Asulox®) 2 to 3-1/3 atrazine 2/5 to 4 2,4-D 1/2 to 3 * *Application of this product plus 2,4-D tank mix at the higher listed ranges may result in crop injury.

PASTURE, HAY, RANGELAND AND GENERAL FARMSTEAD (NON-CROPLAND) This product is labeled for use on pasture, hay, rangeland, general farmstead (non-cropland including fence rows and non-irrigation ditchbanks) for broadleaf weed and brush control. This product may also be applied to non-cropland areas for the control of broadleaf weeds in noxious weed control programs. Districts or areas including broadcast or spot treatment of roadsides and highways, utilities, railroad and pipeline rights-of-way. Noxious weeds must be recognized at the state level but programs may be administered at state, county or other level.

Observe all precautions and restrictions. Read and follow mixing and application instructions. Do not apply within 7 days of harvesting of grass hay.

This product uses described in this section also pertain to small grains (such as barley, forage sorghum, oats, rye, Sudangrass or wheat) grown for pasture use only.

Newly seeded areas, including small grains grown for pasture may be severely injured if rates of this product greater than 1 pint/A are applied.

Established grass crops growing under stress can exhibit various injury symptoms that may be more pronounced if herbicides are applied. Furthermore, rates of this product in excess of 2 quarts (2 lbs. a.i.) per treated acre may cause temporary injury to many grass species.

Bentgrass, carpetgrass, buffalograss and St. Augustine grass may be injured at rates exceeding 1 pint this product (1/2 lb. a.i.) per treated acre. Usually colonial bentgrasses are more tolerant than creeping types. Velvetgrasses are most easily injured. Treatments will kill or injure alfalfa, clovers, lespedeza, wild winter peas, vetch and other legumes.

Animals cannot be removed from treated area for slaughter prior to 30 days after last application. There is no waiting period between treatment and grazing for non-lactating animals.

TIMING RESTRICTIONS FOR LACTATING DAIRY ANIMALS FOLLOWING TREATMENT This Product Rate per Treated Acre Days Before Grazing Days Before Hay Harvest Up to 1 pint (1/2 lb. a.i.) 7 days 37 days Up to 1 quart (1 lb. a.i.) 21 days 51 days Up to 2 quarts (2 lbs. a.i.) 40 days 70 days Observe all precautions and restrictions on labels of products used in tank mixtures.

This product contains 0.5 pounds a.e. of dicamba per pint. When tank mixing with products that contain dicamba, do not exceed a combined total of 1.0 pound of a.e. per acre per application.

24

MIXING AND APPLICATION This product can be applied using water, oil in water emulsions including invert systems, or sprayable fluid fertilizer as a carrier. Conduct a compatibility test (see “COMPATIBILITY TEST” section) prior to tank mixing.

To prepare oil in water emulsions, half-fill spray tank with water. Then add the appropriate amount of emulsifier with continuous agitation. Slowly add the herbicide and then the oil (such as diesel oil or fuel oil) or a premix of oil plus additional emulsifier to spray tank. Complete filling of spray tank with water. Maintain vigorous agitation during spray operation to prevent oil and water from forming separate layers.

This product may be applied broadcast using either ground or aerial application equipment. When using ground equipment, apply 3 to 600 gallons of diluted spray per treated acre. Volume of spray applied will depend on the height, density, and type of weeds or brush being treated and on the type of equipment being used. When using aerial equipment, apply 2 to 40 gallons of diluted spray per treated acre in a water-based carrier.

This product may be applied to individual clumps or small areas (spot treatment) of undesirable vegetation using handgun or similar types of application equipment. Apply diluted sprays to allow complete wetting (up to run-off) of foliage and stems.

Herbicide adjuvants or other spray additives (emulsifiers, surfactants, wetting agents, drift control agents, or penetrants) may be used for wetting, penetration, or drift control. Spray additives must be agriculturally approved when used in pasture applications. If spray additives are used, read and follow all use instructions and precautions on product label.

WEEDS CONTROLLED This product, when applied at label rates, will give control of many annual, biennial, and perennial broadleaf weeds, and many woody brush, tree and vine species commonly found in pasture, hay, rangeland and general farmstead (non-cropland) areas (Refer to “WEED LIST”). Perennial weeds noted with a asterisk (*) in “WEED LIST” may be controlled with lower rates of either this product or this product plus 2,4-D. See “RATES AND TIMINGS” below.

25 RATES AND TIMINGS Application rates and timings of this product are given below. Use the higher level of listed rate ranges when treating dense or tall vegetative growth. Weed Stage & Type Product Amount Broadcast Rate Per Treated Acre (lbs. a.i.) Annual Small, actively growing 1/2 to 1 pt. 1/4 to 1/2 Established weed growth 1 to 1-1/2 pts. 1/2 to 3/4 Biennial1 - Rosette diameter Less than 3 inches 1/2 to 1 pt. 1/4 to 1/2 3 inches or more 1 to 2 pts. 1/2 to 1 Bolting 2 to 3 pts. 1 to 1-1/2 Perennial Suppression or top growth control 1/2 to 1 qt. 1/2 to 1 Noted () Perennials in “WEED LIST” 1 to 2 qts. 1 to 2** Other Perennials 2 qts. 2** Woody Brush, Trees & Vines Top growth suppression 1/2 to 1 qt. 1/2 to 1 Top growth control2 1 to 2 qts. 1 to 2** Stems and stem suppression 2 qts. 2** 1 For best performance, make application when biennial weeds are in the rosette stage. 2 Woody brush, tree and vine species noted with asterisk () in “WEEDS LIST” section will require tank mixtures for adequate control. **Rates above 2.0 lbs. a.i./A are spot treatments only. Do not broadcast apply more than 1.0 lb. a.i./A.

Retreatments may be made as needed; however, do not exceed a total of 2 quarts (2 lbs. a.i.) of this product per treated acre during a growing season.

TANK MIX TREATMENTS Read and follow the label of each tank mix product used for precautionary statements, directions for use, application rates and other restrictions. This product may be tank mixed with one or more of the following herbicides for control of grasses, additional broadleaf weeds, and woody brush, trees and vines. HERBICIDE RATE PER TREATED ACRE (LBS. A.I.) Pasture, hay, rangeland and general farmstead (non-cropland) use: glyphosate (AgSaver™ Glyphosate 41% Plus, Gly Star® Original, Roundup®) 3/4 to 3-3/4 metsulfuron methyl (Ally®) 0.0038 to 0.011 paraquat (Gramoxone®) 1/2 to 1 picloram (TordonTM) 1/8 to 3 tricolopyr (GarlonTM) 3/4 to 9 2,4-D 1/4 to 6

Due to variations that may occur in formulated products and specific use ingredients (e.g. water supplies), conduct a compatibility test (see “COMPATIBILITY TEST” section) prior to actual tank mixing if applicator has no prior experience with that tank mix.

26 CUT SURFACE TREE TREATMENTS This product may be applied as a cut surface treatment for control of unwanted trees and prevention of sprouts of cut trees. Use a mix of 1 part of this product with 1 to 3 parts water in application. Use the lower dilution when treating difficult-to-control species.

FRILL OR GIRDLE TREATMENTS: Make a continuous cut or a series of overlapping cuts using an axe to girdle tree trunk. Spray or paint cut surface with this product/water mix.

STUMP TREATMENTS: Spray or paint freshly cut surface with the water mix. Thoroughly wet the area adjacent to the bark.

NOTE: For more rapid foliar effects, 2,4-D may be added to this product/water mix.

DORMANT APPLICATIONS FOR CONTROL OF MULTIFLORA ROSE This product can be applied when plants are dormant as an undil uted SPOT-CONCENTRATE directly to the soil or as a LO-OIL BASAL BARK treatment using an oil-water emulsion solution.

Apply SPOT-CONCENTRATE applications of this product directly to the soil as close as possible to the root crown but within 6 to 8 inches of the crown. On sloping terrain, make applications to the uphill side of the crown. Do not make application when snow or water prevents applying this product directly to the soil. The use rate of this product is dependent on the canopy diameter of the multiflora rose. Examples: Use this product at 1/4, 1 or 2-1/4 fluid ounces of product respectively, for 5, 10, or 15 feet canopy diameters. Do not exceed a total of 2 qts. this product per acre per year.

Apply LO-OIL BASAL BARK applications of this product to the basal stem regions from the ground line up to a height of 12 to 18 inches. Spray until runoff, with special emphasis on covering the root crown. For best results, make application when plants are dormant. Do not make application after bud break or when plants are showing signs of active growth. Do not make application when snow or water prevents applying this product to the ground line. Refer to “MIXING AND APPLICATIONS” above in this section for method of preparing oil-in-water emulsion. Example for making approximately 2 gallons of a LO-OIL spray mixture: combine 1-1/2 gallons water plus 1 ounce emulsifier plus 1 pint this product plus 2-1/2 pints of No. 2 diesel fuel. Adjust amounts of materials used proportionately to the amount of final spray solution desired. Do not exceed 8 gallons of spray solution mix applied per acre per year.

CONSERVATION RESERVE PROGRAM (CRP) ACRES This product can be used on both newly seeded and established grasses grown in Conservation Reserve or Federal Set-Aside Programs.

Observe all precautions, restrictions, and “MIXING AND APPLICATION” directions.

This product treatment will injure or may kill alfalfa, clovers, lespedeza, wild winter peas, vetch, and other legumes.

27 Agriculturally approved surfactants may be added to the spray mixture to improve post-emergence weed control, particularly in dry growing conditions.

Do not use adjuvants containing penetrants such as petroleum-based oils after grass emergence on newly seeded grasses.

This product contains 0.5 pounds a.e. of dicamba per pint. When tank mixing with products that contain dicamba, do not exceed a combined total of 1.0 pound of a.e. per acre per application.

NEWLY SEEDED AREAS This product may be applied either preplant or post-emergence t o newly seeded grasses or small grains such as barley, oats, rye, Sudangrass, wheat, or other g rain species grown as a cover crop. Post- emergence applications may be made after seedling grasses excee d the 3-leaf stage. Rates of this product greater than 1 pint per treated acre may severely injure newly seeded grasses.

Preplant applications: Injury to new seedlings may occur if intervals between application and grass planting are less than 45 days per pint of this product per treated acre west of the Mississippi River or 20 days per pint east of the Mississippi River.

ESTABLISHED GRASS STANDS Established grass stands are perennial grasses planted one or more seasons prior to treatment. Certain species, bentgrass, carpetgrass, smooth brome, buffalograss or St. Augustine grass, may be injured when treated with this product at rates exceeding 1 pint per treated acre.

WEEDS CONTROLLED This product, when applied at label rates, will control many annual and biennial weeds and provide control or suppression of many perennial weeds (Refer to “WEED LIST”).

28

RATES AND TIMINGS Application rates and timings of this product treatments are given below. Use the higher rate of the rate range when vegetation is either dense or tall, or when weeds are growing under stressed conditions such as drought or cool temperature.

Weed Type* & Stage Broadcast Rate Per Treated Acre Amount of formulated this product (pts.) Equivalent lbs. a.i. Annuals Small, actively growing 1/4 to 1 1/8 to 1/2 Established weed growth 1 1/2 Biennials** - Rosette diameter: Less than 3 inches 1/2 to 1 1/4 to 1/2 3 inches or more 1 to 2 1/2 to 1 Bolting biennial 2 to 3 1 to 1-1/2 Perennials** Suppression/Control 2 to 4 1 to 2

  • For best results, treat biennial weeds with this product when they are in the rosette stage of growth. Retreatments may be made as needed; however, do not exceed a total of 2 quarts (2 lbs. a.i.) of this product per treated acre during a growing season. ** Biennial and perennial weeds will require follow-up (sequent ial) treatments for seedling control and escapes.

TANK MIX TREATMENTS To control grasses and additional broadleaf weeds, this product may be tank mixed with other herbicides registered for use in Conservation Reserve Programs such as 2,4-D, glyphosate (AgSaver™ Glyphosate 41% Plus, Gly Star® Original or Roundup®), paraquat (Gramoxone®), metsulfuron (Ally®) and others.

Read and follow the label of each tank mix product used for precautionary statements, directions for use, application rates, and other restrictions.

ASPARAGUS FOR USE ONLY IN THE STATES OF CALIFORNIA, OREGON AND WASHINGTON Observe all precautions and restrictions. Read and follow mixing and application instructions.

If spray contacts emerged spears, crooking (twisting) of some spears may result. If such crooking occurs, discard affected spears.

Do not harvest prior to 24 hours after treatment. Do not use in the Coachella Valley of California.

Two applications may be made per growing season. Do not exceed a total of 1 pint of this product per treated acre per crop year.

This product contains 0.5 pounds a.e. of dicamba per pint. When tank mixing with products that contain dicamba, do not exceed a combined total of 1.0 pound of a.e. per acre per application.

29

RATES AND TIMINGS Apply this product to emerged and actively growing weeds in 40 to 60 gallons of diluted spray per treated acre immediately after cutting the field, but at least 24 hours before the next cutting. WEEDS RATE PER TREATED ACRE Mustard, Black Pigweed, Redroot (Carelessweed) Sowthistle, Annual *Thistle, Canada Thistle, Russian 1/2 to 1 pt. (1/4 to 1/2 lb. a.i.) Bindweed, Field Chickweed, Common Goosefoot, Nettleleaf Radish, Wild Thistle, Milk 1 pt. (1/2 lb. a.i.) This product may be applied in a tank mixture with either AgSaver™ Glyphosate 41% Plus, 2,4-D, GlyStar® Original or Roundup® for improved control of noted () weeds above. Read and follow respective product labeling for precautionary statements, directions for use, application rates and timings, and other restrictions.

TURF FOR USE IN GENERAL FARMSTEAD (NON-CROPLAND) AND SOD FARMS Not for residential use. Observe all directions, precautions and restrictions. Read and follow mixing and application instructions.

To avoid injury to newly seeded grasses, delay application of this product until after the second mowing. Furthermore, application rates in excess of 1 pint (1/2 lb. a.i.) per treated acre may cause noticeable stunting or discoloration of sensitive grass species such as bentgrass, carpetgrass, buffalograss, and St. Augustine grass.

In areas where roots of sensitive plants extend, do not apply in excess of 1/4 pint (1/8 lb. a.i.) of this product per treated acre on coarse-textured (sandy-type) soils, or in excess of 1/2 pint (1/4 lb. a.i.) per treated acre on fine-textured (clay-type) soils. Do not make repeat applications in these areas for 30 days and until previous applications of this product have been activated in the soil by rain or irrigation.

This product contains 0.5 pounds a.e. of dicamba per pint. When tank mixing with products that contain dicamba, do not exceed a combined total of 1.0 pound of a.e. per acre per application.

WEEDS CONTROLLED

This product, when applied at label rates, will give control of many annual, biennial, and perennial broadleaf weeds noted (*) in “WEED LIST” commonly found in turf. This product will also give growth suppression of many other listed perennial broadleaf weeds and woody brush, tree, and vine species (Refer to “WEED LIST”).

30

MIXING AND APPLICATION Apply 30 to 200 gallons of diluted spray per treated acre (3 qts. to 4-1/4 gals. per 1,000 sq. ft.), depending on density or height of weeds treated and on the type of equipment used.

RATES AND TIMINGS Use the higher level of listed rate ranges when treating dense vegetative growth. Weed Stage & Type THIS PRODUCT Pints per treated acre Pounds a.i. per treated acre Annuals Small, actively growing Established weed growth

1/2 to 1 1 to 1-1/2

1/4 to 1/2 1/2 to 3/4 Biennials - Rosette diameter Less than 3 inches 3 inches or more

1/2 to 1 1 to 2

1/4 to 1/2 1/2 to 1 Perennials, Woody Brush, Trees & Vines 1 to 2 1/2 to 1

For best performance, apply when weeds are emerged and actively growing.

Retreatments may be made as needed; do not exceed a total of 2 pints (1 lb. a.i.) this product per treated acre during a growing season

TANK MIX TREATMENTS Read and follow the label of each tank mix product used for precautionary statements, directions for use, application rates and timings and other restrictions.

Tank mix treatments of this product may be made with 2,4-D, MCPA, MCPP, or bromoxynil for control of additional weeds listed on the tank mix product label.

Apply 1/5 to 1/2 pint (1/10 to 1/4 lb. a.i.) of this product per treated acre with 1/2 to 1-1/2 lbs. acid equivalent (a.e.) of 2,4-D, MCPA, MCPP, or with 3/8 to 1/2 lb. a.i. of bromoxynil. Use the higher level of the listed rate ranges when treating established weeds. Repeat treatments may be made as needed; however, do not exceed 2 pints (1 lb. a.i.) of this product per treated acre during the growing season.

GRASS SEED CROPS GRASSES GROWN FOR SEED SUCH AS BERMUDAGRASS, BLUEGRASS, FESCUE AND RYEGRASS Observe all precautions and restrictions. Read and follow mixing and application instructions. Refer to the “PASTURE, HAY, RANGELAND, AND GENERAL FARMSTEAD (NON-CROPLAND)” section for grazing and feeding restrictions.

Do not use on bentgrass unless possible crop injury can be tolerated.

This product contains 0.5 pounds a.e. of dicamba per pint. When tank mixing with products that contain dicamba, do not exceed a combined total of 1.0 pound of a.e. per acre per application.

31

WEEDS CONTROLLED This product will provide control or suppression of annual broadleaf weeds listed below. For improved control of listed weeds plus additional weeds, this product may be applied in a tank mix with other herbicides.

Alfalfa1 Bedstraw, Catchweed Bindweed, Field Buttercup, Corn Buttercup, Creeping Buttercup, Western Field Catchfly, Nightflowering

1 Top growth only Chamomile, Corn Chickweed, Common Chickweed, Mouseear Clover Cockle, White Dock, Broadleaf Dock, Curly Hemlock, Poison Knapweed, Russian1 Knawel Knotweed, Prostrate Kochia Ladysthumb Lambsquarters, Common Lettuce, Prickly Mayweed (Dogfennel) Ragwort, Tansy Sorrel, Red (Sheep Sorrel) Sowthistle, Annual Starwort, Little Thistle, Canada1

RATES AND TIMINGS Apply 1/2 to 1 pint of this product per treated acre on seedling grass after the crop reaches the 3 to 5 leaf stage. Apply up to 2 pints of this product on well-established perennial grass. Do not apply after the grass seed crop begins to joint. For best performance, make applications when weeds are in the 2 to 4 leaf stage and rosettes are less than 2 inches across. Use the higher level of listed rate ranges when treating more mature weeds or dense vegetative growth.

TANK MIX TREATMENTS For control of grasses or additional broadleaf weeds, this product may be tank mixed with all broadleaf herbicides registered for use in Grass Seed Production. Read and follow the label of each tank mix product used for precautionary statements, directions for use, weeds controlled and geographic and other restrictions.

BROADCAST RATE PER TREATED ACRE Apply 1/2 to 2 pints this product with: PRODUCT ACTIVE INGREDIENT FORMULATION AMOUNT OF PRODUCT PER ACRE 2,4-D amine or ester 2,4-D 4 lbs./gal. 1 to 4 pts. (0.5 to 2.0 lbs. a.i. /A)1 MCPA amine MCPA 4 lbs./gal. 1 to 2 pts. (0.5 to 1.0 lb. a.i. /A)1 BROX™ 2EC Herbicide, Buctril® bromoxynil2 2 lbs./gal. 1 to 2 pts. Curtail™ clopyralid + 2,4-D 2.38 lbs./gal. 1-3/4 to 4 pts. Karmex® diuron2 80% DF 2 to 4 lbs. Stinger™ clopyralid 3 lbs./gal. 1/4 to 1 pt.

1 When using formulations other than 4 lb. /gal., use pounds active/acre listed. 2 Herbicides with the same common name and/or different formulations may be used.

32 ANNUAL GRASS CONTROL For suppression of annual grass weeds such as: Brome, Downy (Cheatgrass); Brome, Ripgut; Fescue, Rattail; and Windgrass

Apply up to 4 pints of this product per treated acre in the fall or late summer after harvest and burning of established grass seed crops. Make applications immediately following the first irrigation when the soil is moist and before weeds have more than 2 leaves.

PREPLANT DIRECTIONS (POST-HARVEST/FALLOW/CROP STUBBLE/SET-A-SIDE) FOR BROADLEAF WEED CONTROL BEFORE WHEAT, CORN, SORGHUM, SOYBEANS Observe all precautions and restrictions. Read and follow mixing and application instructions.

WEEDS CONTROLLED This product may be applied alone or in tank mix combinations with other herbicides registered for this use.

This product can be applied either post-harvest in the fall, spring or summer, during the fallow period or to crop stubble/set-a-side acres. This product, when applied at the label rates, will control many annual broadleaf weeds. See the “WEEDS CONTROLLED” section under small grains. In addition, this product will control or suppress the following biennial and perennial broadleaf weeds.

Alfalfa1 Artichoke, Jerusalem Bindweed, Field Bindweed, Hedge Blueweed, Texas Bursage (Bur Ragweed, Povertyweed, Lakeweed)1 Dandelion, Common1 Dock, Curly1 Dogbane, Hemp Garlic, Wild2 Horsenettle, Carolina Knapweed, Spotted Trumpetcreeper (Buckvine) Knapweed, Diffuse Nightshade, Silver Redvine Smartweed, Swamp Sowthistle, Perennial1 Spurge, Leafy Thistle, Bull Thistle, Canada2 Thistle, Milk Thistle, Musk Thistle, Plumeless Thistle, Scotch

1 Perennials may be controlled using this product at rates lower than those for other listed perennial weeds. (See “RATES AND TI MINGS” under this heading). 2 See the “SPECIAL TANK MIX TREATMENTS” section under this heading for specific control programs for these weeds.

RATES AND TIMINGS Apply this product as a broadcast or spot treatment to emerged and actively growing weeds after crop harvest (post-harvest) and before a killing frost or in the fallow cropland or crop stubble the following spring or summer. Agriculturally-approved spray additives, such as surfactants or oils, may be used to enhance spray coverage and the herbicide's penetration of weed foliage. See “CROPPING RESTRICTIONS” for required interval between application and planting to prevent crop injury.

For best performance, make application when annual weeds are less than 6-inches tall, when biennial weeds are in the rosette stage, and to perennial weed regrowth in late summer or fall following a mowing or tillage treatment. Most effective control of upright perennial broadleaf weeds, such as Canada thistle and Jerusalem artichoke, occurs if application is made when the majority of weeds, such as field bindweed and hedge bindweed, are in or beyond the full bloom stage.

33 Avoid disturbing treated areas following application. Treatments may not kill weeds which develop from seed or underground plant parts, such as rhizomes or bulblets, after the effective period for this product. For seedling control, a follow-up program or other cultural practices could be instituted. For small grain in-crop uses of this product, see the “RATES AND TIMINGS” section under the “SMALL GRAINS” heading for details.

THIS PRODUCT RATES PER TREATED ACRE WEED TYPE AMOUNT OF PRODUCT PER ACRE Annual 1/2 to 1 pt. (8 to 16 fl. oz.) Biennial 1 to 2 pts. (16 to 32 fl. oz.) Perennial 1 to 4 pts. (16 to 64 fl. oz.) Perennial suppression 1 to 2 pts. (16 to 32 fl. oz.) Noted (*) Perennials in “WEED LIST” 2 to 4 pts. (32 to 64 fl. oz.) Other Perennials 4 pts. (64 fl. oz.) Retreatments may be made as needed; however, do not exceed a total of 4 pints of this product per treated acre during any given period.

TANK MIX TREATMENTS This product may be tank mixed with one or more of the following herbicides for control of grasses or additional broadleaf weeds. Read and follow the label of each tank mix product used for precautionary statements, directions for use, rates and timings, weeds controlled, geographic and other restrictions.

THIS PRODUCT BROADCAST RATE PER TREATED ACRE FOR ANNUAL WEED CONTROL Apply 1/4 to 1 pint this product with:

PRODUCT ACTIVE INGREDIENT FORMULATION AMOUNT OF PRODUCT PER ACR E Aatrex® 4L1 atrazine 4 lbs. /gal. 0.5 to 6 pts. Aatrex® Nine-O®1 atrazine 90% DF 0.5 to 3-1/3 lbs. Ally®2 metsulfuron-methyl 75% DF 0.1 oz. Amber®2 triasulfuron 75% DF 0.28 to 0.35 oz. Cyclone® paraquat 2 lbs. /gal. 1 to 2 pts. Fallow Star™ or Fallow Master™ glyphosate + dicamba 1.6 lbs. /gal. 22 to 44 fl. oz. Finesse®2 chlorsulfuron + metsulfuron-methyl 75% DF 0.2 oz. Gramoxone® Extra paraquat 2.5 lbs. /gal. 1.5 pts. Kerb®1 pronamide 50-W 0.5 to 1 lb. Landmaster® BW glyphosate + 2,4-D 2.4 lbs./gal. 27 to 54 fl. oz. AgSaver™ Glyphosate 41% Plus, Gly Star® Original, Roundup® or Roundup® RT glyphosate 3 lbs./gal. 8 to 48 fl. oz. Sencor® DF1 metribuzin 75% DF 0.5 to 1 lb. Sencor® 41 metribuzin 4 lbs./gal. 0.75 to 1 5 pts. 2,4-D 2,4-D 4 lbs./gal. 1 to 2 pts. (0.5 to 1 lb. a.i./A)3

1 Tank mixes of this product with these products may be subject to special restrictions. See the product label of the tank mix partner for intended use rates, restrictions and other precautions.

34 2 When tank mixing with sulfonylurea herbicides, refer to the product label for rates and restrictions. Use a surfactant of at least 80% active ingredient at the rate of 1 to 2 quarts/100 gallons of spray or not more than 0.25 to 0.5% by volume. Use the highest rate of surfactant when using the lower rate ranges of the tank mix and/or when treating more mature weeds or dense vegetative growth. Sulfonylurea-resistant weeds may not be controlled by tank mixes of this product and a sulfonylurea. Refer to the this product tank mix section for alternative tank mixes. 3 When using formulations other than 4 lbs./gal., use pounds active/acre listed.

THIS PRODUCT BROADCAST RATE PER TREATED ACRE FOR BIENNIAL AND PERENNIAL WEED CONTROL Apply 1 to 4 pints of this product with: PRODUCT ACTIVE INGREDIENT FORMULATION AMOUNT OF PRODUCT PER ACR E Curtail™ clopyralid + 2,4-D 2.38 lbs./gal. 2 to 4 pts. 2,4-D 2,4-D 4 lbs./gal. 2 to 6 pts. (1.0 to 3 lbs. a.i./A)1 Landmaster® BW glyphosate + 2,4-D 2.4 lbs./gal. 54 fl. oz. AgSaver™ Glyphosate 41% Plus, GlyStar® Original, Roundup® glyphosate 3 lbs./gal. 1 to 5 qts. Roundup® RT glyphosate 3 lbs./gal. 1 to 5 qts. Tordon™ 22K picloram 2 lbs./gal. 1/2 to 1 pt. 1 When using formulations other than 4 lbs./gal., use pounds active/acre listed

SPECIAL TANK MIX TREATMENTS For suppression of perennial weeds, apply 1/2 to 1 pint of this product with 8 to 16 fluid ounces of AgSaver™ Glyphosate 41% Plus, GlyStar®, Original, Roundup® or Roundup® RT per treated acre.

For wild garlic control, apply 1 pint this product with 3 pints of 2,4-D LV ester (4 lbs./gal.) per treated acre. Apply when wild garlic is 4 to 8 inches tall.

For Canada thistle control, use this product, this product plus Curtail™, or this product plus AgSaver™ Glyphosate 41% Plus, Gly Star® Original, Roundup® or Roundup® RT tank mix treatments.

Application may be made during fallow periods for control of volunteer barley, bulbous bluegrass, downy brome, jointed goatgrass, common rye and volunteer wheat when they are actively growing. Use 1 pint this product with 1/2 to 1 lb. Kerb® 50-W. Fall-seeded wheat may be planted 9 months or more after application. For best performance, make application between mid-October and mid- December, prior to soil freeze up.

During fallow periods, apply this product plus Landmaster® BW, Fallow Star™ or Fallow Master™ to give improved control of kochia, wild buckwheat, prickly lettuce, field bindweed and Canada thistle. Use 1/8 to 1/4 pint of this product plus 22 to 54 fluid ounces of Landmaster® BW, Fallow Star™ or Fallow Master™ for annual weed control or 1/4 to 1/2 pint this product plus 22 to 54 fluid ounces of Landmaster® BW, Fallow Star™ or Fallow Master™ for perennial weed suppression.

CROPPING RESTRICTIONS The following instructions are based on this product use rates up to 4 pints per treated acre.

35

Corn, sorghum, and soybeans may be planted in the spring following applications made during the previous year. If less than 1 inch of rainfall occurs between application and first killing frost, cultivate treated areas to allow herbicide to come in contact with moist soil. Cultivation may take place before or immediately after ground thaw.

Soybean injury may occur if the interval between application and planting is less than specified. In areas with greater than 30 inches of rainfall, delay planting for 30 days per pint of this product per treated acre. In areas with less than 30 inches of rainfall, delay planting for 45 days per pint of this product per treated acre. Exclude days when ground is frozen.

Wheat may be planted in the fall or spring following applications. Also, spot application may be made any time prior to crop emergence if crop injury can be tolerated in treated areas. Wheat injury may occur if the interval between application and planting is less than specified.

East of the Mississippi River, the interval is 20 days per pint of this product per treated acre or 1.25 days per 1 ounce. Moisture is essential for this product degradation. Exclude days when ground is frozen.

West of the Mississippi River, the interval is 45 days per pint of this product per treated acre or 3 days per ounce. Moisture is essential for this product degradation. Exclude days when ground is frozen.

Following a normal harvest of barley, oats, or wheat, any rotational crop may be planted. If the interval before harvest is shortened, such as when cover crops will be plowed under, do not follow up with the planting of a sensitive crop.

COTTON PREPLANT APPLICATION Observe all precautions and restrictions. Read and follow mixing and application instructions. Refer to the “WEED LIST” section of this label for a list of weeds controlled or suppressed.

This product contains 0.5 pounds a.e. of dicamba per pint. When tank mixing with products that contain dicamba, do not exceed a combined total of 1.0 pound of a.e. per acre per application.

RATES AND TIMINGS Apply this product as a broadcast or spot treatment to emerged and actively growing weeds at a rate of up to 8 fl. oz./A prior to planting cotton. Most effective control of weeds occurs if application is made when weeds are in the 2 to 4 leaf stage and rosettes are less than 2 inches across.

CROPPING RESTRICTIONS Do not plant cotton for at least 21 days after application and after allowing for a minimum accumulation of 1 inch of rainfall or overhead irrigation. Do not apply west of the Rockies or to geographic areas with average annual rainfall less than 25 inches.

36 TANK MIX TREATMENTS For control of grasses or additional broadleaf weeds, this product may be tank mixed with Caparol®, Gramoxone® Extra, and Roundup Ultra® RT herbicides.

CONTROL OF PERENNIAL BROADLEAF WEEDS IN CROPLAND (SPOT APPLICATION ONLY) FOR USE ONLY IN IDAHO, MONTANA, NEVADA, OREGON, UTAH, AND WASHINGTON STATES Observe all precautions and restrictions. Read and follow mixing and application instructions.

Do not treat sub-irrigated cropland or areas where the soil remains saturated with water throughout the year.

Make only one application of this product per year.

This product contains 0.5 pounds a.e. of dicamba per pint. When tank mixing with products that contain dicamba, do not exceed a combined total of 1.0 pound of a.e. per acre per application. WEEDS CONTROLLED This product, when applied at label rates, will control many broadleaf weeds including: Bindweed, Field Dock, Broadleaf (Bitterdock) Dock, Curly Knapweed, Black Knapweed, Russian Ragwort, Tansy Spurge, Leafy Thistle, Canada

RATES AND TIMINGS This product may be applied at any time following a crop harvest to stubble, fallow or other cropland. Make an application when weeds are actively growing and prior to a killing frost.

Apply 2 quarts (2 lbs. a.i.) of this product per treated acre. Application may be made up to one month prior to the planting of wheat.

Do not use unless injury to wheat or rotated barley will be acceptable.

Barley, oats, corn, sorghum (milo), annual or perennial grass crops may be planted into treated areas one year after application. Do not plant crops grown for seed (other than perennial grass seed) into treated areas until three years after application. Do not plant broadleaf crops such as alfalfa, beans, peas, potatoes, or sugar beets into treated areas until two years after application.

In most cases, treatments will not kill perennial weed seedlings which germinate from seed one or two years after treatment. Once the effect of the chemical has been lost, institute a follow-up program for seedling control or other cultural practices.

WIPER APPLICATION USES Important: Observe all precautions and restrictions. This product may be applied through wiper application equipment to control or suppress actively growing broadleaf weeds, woody brush, trees and vines. Use a solution containing 1 part this product to 1 part water. Do not contact desirable

37 vegetation with herbicide solution. Wiper application must only be made to crops (including “PASTURES”) and “NON-CROPLAND AREAS” described in this label with the exception of “GRAIN SORGHUM (MILO)”.

RIGHTS-OF-WAY, UTILITY AND INDUSTRIAL AREAS, AND FENCEROWS This product may be used for use on non-crop land areas such as rights-of-way (such as roadways, rest areas, utility, railroad, highway, pipeline, and rights-of-way that run through pasture and rangeland); utility facilities (such as substations, pipelines, tank farms, pumping stations, parking and storage areas, fencerows, and non-irrigated ditchbanks); brush control for forest site preparation or maintenance.

Observe all precautions and restrictions on this label. Read and follow the “Mixing and Application” section.

Rights-of-Way This product can be used to control many broadleaf weeds on rights-of-way. This use includes applications to roadside, roadway and highways, to areas along utilities such as cable and powerlines, railroad track and embankment, highways, highway medians, bridge abutments, pipelines, and rights- of-way that run through pasture and rangeland. Use controlled application techniques that minimize the risk of off-target movement.

Utility and Industrial Areas This product can be used to control many broadleaf weeds and brush in noncrop areas on or surrounding substations, pipelines, tank farms, pump stations, production facilities, and bare ground situations. It may also be used on parking and storage areas. Refer to “GROUND AND SURFACE WATERS PROTECTION” and “SENSITIVE CROP PRECAUTIONS”” to avoid direct runoff from impervious surfaces.

Fencerows This product can be used to control many broadleaf weeds and brush in fencerows.

Mixing and Application Read and observe “GROUND AND SURFACE WATERS PROTECTION”, directions and restrictions in this label.

This product can be applied using water, oil in water emulsions including invert systems, or sprayable fluid fertilizer as a carrier. Conduct a compatibility test (see “Compatibility Test” section) prior to tank mixing.

To prepare oil in water emulsions, half-fill spray tank with water, then add the appropriate amount of emulsifier. With continuous agitation, slowly add the herbicide and then the herbicidal oil or a pre-mix of oil plus additional emulsifier to spray tank. Complete filling of spray tank with water. Maintain vigorous agitation during spray operation to prevent oil and water from forming separate layers.

38 This product may be applied broadcast using either ground or aerial application equipment. When using ground equipment, apply low or high volume sprays of between 3 to 600 gallons of diluted spray per treated acre. Volume of spray applied will depend on the height, density, and type of weeds or brush being treated and on the type of equipment being used. When using aerial equipment, apply 5 to 40 gallons of diluted spray per treated acre.

This product may be applied to individual clumps or small areas (spot treatment) of undesirable vegetation using handgun or similar types of application equipment. Apply diluted sprays to allow complete wetting (up to runoff) of foliage and stems.

Herbicide adjuvants or other spray additives (emulsifiers, spreader stickers, surfactants, wetting agents, drift control agents, or penetrants) may be used for wetting, penetration, or drift control. Spray additives must be agriculturally-approved when used in pasture applications. If spray additives are used, read and follow all use directions, restrictions, and precautions on product label.

Weeds and Brush Controlled This product, when applied at specified rates, will give control of many annual, biennial, and perennial broadleaf weeds, and many woody brush, trees and vine species commonly found in non-crop land areas (Refer to “Weed List”). Noted (*) perennial weeds listed in “WEED LIST” may be controlled with lower rates of either this product or this product plus tank mix combinations. See “RATES AND TIMINGS” below.

RATES AND TIMINGS Application rates and timings of this product are given below. Use the higher level of listed rate ranges when treating dense or tall vegetative growth. Weed Stage and Type Amount of Product Per Acre Gals. of Spray Mixture Per Acre** Spray Concentration for Low-Volume Application**** (%vol/vol) Annual Small, Actively Growing Established weed growth

1/2 to 1 pt. 1 to 1-1/2 pts.

25 to 50 50 to 70

3 3 Biennial* - Rosette diameter Less than 3 inches 3 inches or more Bolting

1/2 to 1 pt. 1 to 2 pts. 2 to 3 pts.

25 to 50 50 to 100 100 to 150

3 to 4 3 to 4 3 to 4 Perennial Suppression or top growth control Noted (*) Perennials in “Weed List” Other Perennials

1/2 to 1 pt. 2 to 4 pts. 4 pts.

50 to 100 100 to 200 200

4 4 5 Woody Brush, Trees & Vines*** Top Growth Stems and Roots

1/2 to 4 pts. 4 pts.

50 to 200 200

5 5

  • For best performance, make application when biennial weeds are in the rosette stage. ** Assuming typical application rate of 1 qt. of this product/100 gals. *** Tank mixes may be required for optimal control. Refer to “WEED LIST”. **** Low volume rates must not exceed 4 pts. of this product maximum per acre per year (5% volume/volume = 10 gallons maximum solution per acre per year).

39 Retreatments may be made as needed; however, do not exceed a total of 4 pts. (2 lbs. a.i.) of this product per treated acre during a growing season.

Tank Mix Options for Rights-Of-Way, Utility and Industrial Areas, and Fencerows This product may be tank mixed with other herbicides for additional weed control. The following table lists example options, but does not limit tank mix options.

READ AND FOLLOW THE LABEL OF EACH TANK MIX PRODUCT USED FOR PRECAUTIONARY STATE- MENTS, DIRECTIONS FOR USE, APPLICATION RATES, AND OTHER RESTRICTIONS. Consult product labels for application rates for tank mix partners.

Herbicide Rates Per Treated Acre (lbs. a.i.) norflurazon (Predict®) Consult product labels for application rates prodiamine (Endurance®) glufosinate (Finale®) glyphosate (AgSaver™ Glyphosate 41% Plus1, Roundup®, Accord®) metsulfuron methyl (Escort®) pendimethalin (Pendulum®) triclopyr (Garlon®) clopyralid (Transline®) bromacil (Hyvar®) chlorsulfuron (Telar®) diquat (Reward®) simazine (Princep®) diuron (Karmex®) fosamine ammonium (Krenite®) hexazinone (Velpar®) imazapyr (Arsenal®) imazemethapyr (Plateau®) sulfometuron methyl (Oust®) sulfosate (Touchdown®) tebuthiuron (Spike®) 2,4-D 1 This product plus dicamba tank mixtures must not be applied by air in CA. Due to the differences that may occur between specific formulated products and specific use ingredients (e.g., water supplies), a compatibility test (see “Compatibility Test” section) is recommended prior to actual tank mixing.

40

STORAGE AND DISPOSAL Do not contaminate water, food, or feed by storage or disposal. Open dumping is prohibited. This product may not be mixed, loaded, or used within 50 feet of all wells including abandoned wells, drainage wells, and sinkholes. PESTICIDE STORAGE: Store in original container in a well-ventilated area separately from fertilizer, feed and foodstuffs. Avoid cross-contamination with other pesticides. Spillage or leakage must be contained and absorbed with clay granules, sawdust, or equivalent material for disposal. PESTICIDE DISPOSAL: Triple rinse pesticide from containers and use rinsates in the pesticide application. Wastes which cannot be used according to label instructions may be disposed of on site or at an approved waste disposal facility. CONTAINER DISPOSAL: {Nonrefillable container. Do not reuse or refill this container. Triple rinse container (or equivalent) promptly after emptying. {{(Nonrefillable ч 5 gallons:)} Triple rinse as follows: Empty the remaining contents into application equipment or a mix tank and drain for 10 seconds after the flow begins to drip. Fill the container ¼ full with water and recap. Shake for 10 seconds. Pour rinsate into application equipment or a mix tank or store rinsate for later use or disposal. Drain for 10 seconds after the flow begins to drip. Repeat this procedure two more times. Then offer for recycling if available or puncture and dispose of in a sanitary landfill, or by incineration, or, if allowed by state and local authorities, by burning. If burned, stay out of smoke} {AND/OR} {{(Nonrefillable > 5 gallons:)} Triple rinse as follows: Empty the remaining contents into application equipment or a mix tank. Fill the container ¼ full with water. Replace and tighten closures. Tip container on its side and roll it back and forth, ensuring at least one complete revolution, for 30 seconds. Stand the container on its end and tip it back and forth several times. Turn the container over onto its other end and tip it back and forth several times. Empty the rinsate into application equipment or a mix tank or store rinsate for later use or disposal. Repeat this procedure two more times. Then offer for recycling if available or puncture and dispose of in a sanitary landfill, or by incineration, or, if allowed by state and local authorities, by burning. If burned, stay out of smoke.}}{AND/OR} {{Refillable container {250 gallon & bulk}:} Refill this container with pesticide only. Do not reuse this container for any other purpose. Cleaning the container before final disposal is the responsibility of the person disposing of the container. Cleaning before refilling is the responsibility of the refiner.

To clean the container before final disposal, empty the remaining contents from the container into application equipment or mix tank. Fill the container about 10 percent full with water. Agitate vigorously or recirculate water with the pump for 2 minutes. Pour or pump rinsate into application equipment or rinsate collection system. Repeat this rinsing process two more times.}

41

18.0 WARRANTY DISCLAIMER The directions for use of this product must be followed carefully. TO THE EX TENT CONSISTENT WITH APPLICABLE LAW, (1) THE GOODS DELIVERED TO YOU ARE FURNISHED AS IS BY MANUFACTURER OR SE LLER, AND (2) MANUFACTURER AND SELLER MAKE NO WARRANTIES, GUARANTEES, OR REPRESENTATI ONS OF ANY KIND TO BUYER OR USER, EITHER EXPRESS OR IMPLIED, OR BY USAGE OF TRADE, STATUTORY OR OTHERWISE, WITH REGARD TO THE PRODUCT SOLD, INCLUDING, BUT NOT LIMITED TO MERCHANTABILITY , FITNESS FOR A PARTICULAR PURPOSE, USE, OR ELIGIBILITY OF THE PRODUCT FOR ANY PARTICULAR TRADE USAGE. UNINTENDED CONSEQUENCES, INCLUDING BUT NOT LIMITED TO INEFFECTI VENESS, CROP OR PLANT DAMAGE, OR LOSS OF YIELD, MAY RESULT BECAUSE OF SUCH FACTORS AS THE PRE SENCE OR ABSENCE OF OTHER MATERIALS USED IN COMBINATION WITH THE GOODS, OR THE WEATHER, W IND, AND TEMPERATURE, OR THE MANNER OF USE OR APPLICATION, ALL OF WHICH ARE BEYOND THE CONTRO L OF MANUFACTURER OR SELLER, AND ASSUMED BY BUYER OR USER. THIS WRITING CONTAINS ALL OF THE REPRESENTATIONS AND AGREEMENTS BETWEEN BUYER OR MANUFACTURER, AND SELLER, AND NO PE RSON OR AGENT OF MANUFACTURER OR SELLER HAS ANY AUTHORITY TO MAKE ANY OTHER REPR ESENTATION OR WARRANTY OR AGREEMENT RELATING IN ANY WAY TO THESE GOODS. NO WARRANTIES SHA LL BE CREATED BY COURSE OF DEALING, USAGE OF TRADE, OR COUR SE OF PERFORMANCE. THERE ARE NO WARRANTIES THAT EXTEND BEYOND THE FACE HEREOF. THE SELLER AND MANUFACTURER ASSUME NO R ESPONSIBILITY THAT THE GOODS WILL BE FIT FOR ANY PARTICULAR PURPOSE FOR WHICH YOU MAY BE BUYING OR USING THE GOODS. LIMITATION OF LIABILITY WARNING TO THE EXTENT CONSISTENT WITH APPLICABLE LAW, IN NO EVENT SHALL MANUFACTURER OR SELLER BE LIABLE FOR SPECIAL, INCIDENTAL, OR CONSEQUENTIAL DAMAGES, OR FO R DAMAGES IN THEIR NATURE OF PENALTIES RELATING TO THE GOODS SOLD, INCLUDING USE, APPLICATIO N, HANDLING, AND DISPOSAL. TO THE EXTENT CONSISTENT WITH APPLICABLE LAW, NEITHER MANUFACTURER NOR SELLER SHALL BE LIABLE TO BUYER OR USER OR TO CUSTOMERS OF BUYER, IF ANY, FOR INDEMNIFICA TION OR ANY DAMAGES OR SUMS OF MONEY, CLAIMS OR DEMANDS WHATSOEVER, RESULTING FROM OR BY REASO N OF, OR RISING OUT OF THE USE, MISUSE, OR FAILURE TO FOLLOW LABEL WARNINGS OR INSTRUCTION S FOR USE, OF THE GOODS SOLD. ALL SUCH RISKS SHALL BE ASSUMED BY THE BUYER, USER, OR CUSTOMER S. TO THE EXTENT CONSISTENT WITH APPLICABLE LAW, BUYER'S OR USER'S EXCLUSIVE REMEDY, AND MA NUFACTURER'S OR SELLER'S TOTAL LIABILITY, SHALL BE FOR DAMAGES NOT EXCEEDING THE PURCHASE PRIC E OF THE GOODS AND, IF BUYER OR USER WISHES, THE RETURN OF THE GOODS BY BUYER TO SELLER. If you do not agree with or do not accept any of directions for use, the warranty disclaimers, or limitations on liability, do not use the goods, and return it unopened to the Seller, and the purchase price will be refunded. By using the goods, you expressly agree to all of the terms and conditions of this contract. USES WITH OTHER PRODUCTS (TANK MIXES) If the goods are used in combination with any other product except as specifically directed in writing or on the label , then Seller or Manufacturer shall have no liability for any c rop, plant, or other loss, damage, or injury arising out of its use in any such combination not so specifically directed.

REGISTERED TRADEMARKS AgSaver™ is a trademark of AgSaver, LLC BROX™ is a trademark and AgriStar®, Fallow Star®, and Gly Star® are registered trademarks of Albaugh Inc. Arsenal®, Clarity®, Frontier®, Guardsman®, Pendulum®, Plateau® and Prowl® are registered trademarks of BASF Ag Products. Asulox®, Bronate®, Buctril®, Dakota®, Sencor® and Tiller® are registered trademarks of Bayer CropScience. Finale® is a registered trademark of Bayer Environmental Science. Accord®, Broadstrike™, Curtail™, Garlon™, Stinger™, Spike®, Surpass™, Tordon™, Transline® are trademarks of Dow AgroSciences LLC. Accent®, Ally®, Escort®, Express®, Finesse®, Glean®, Harmony®, Hyvar®, Karmex®, Krenite®, Oust®, Telar, and Velpar® are registered trademarks of E.I. duPont de Nemours & Co., Inc. Battalion®, Bullet®, Fallow Master®, Harness®, Landmaster®, Lariat®, Lasso®, Partner®, Permit®, Ramrod®, Roundup®, and Screen® are registered trademarks of the Monsanto Company. Kerb® is a registered trademark of Rohm and Haas Company. Aatrex®, Aatrex® Nine-O®, Amber®, Beacon®, Caparol®, Concep®, Cyclone®, Dual II Magnum®, Endurance®, Eradicane®, Evik®, Gramoxone®, Predict®, Princep®, Sutan +®, Reward®, Touchdown®, and Tough® are registered trademarks of Syngenta Group Company. 180402